Rabbit monoclonal anti-ERK3 antibody for SISCAPA, clone OTIR5F3
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit monoclonal anti-ERK3 antibody for SISCAPA, clone OTIR5F3
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal anti-p97 MAPK antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human p97 MAPK. |
Rabbit Polyclonal Anti-p97 MAPK Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-p97 MAPK Antibody: A synthesized peptide derived from human p97 MAPK |
Rabbit polyclonal anti-MAPK9 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MAPK9. |
Rabbit polyclonal Anti-MAPK6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAPK6 antibody: synthetic peptide directed towards the middle region of human MAPK6. Synthetic peptide located within the following region: QVDPRKYLDGDREKYLEDPAFDTNYSTEPCWQYSDHHENKYCDLECSHTC |
Carrier-free (BSA/glycerol-free) ERK3 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ERK3 mouse monoclonal antibody, clone OTI5E1 (formerly 5E1)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MAPK6 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MAPK6 |
MAPK6 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MAPK6 |
MAPK6 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 372-721 of human MAPK6 (NP_002739.1). |
Modifications | Unmodified |
MAPK6 Rabbit monoclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Anti-ERK3 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-ERK3 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-ERK3 mouse monoclonal antibody, clone OTI5E1 (formerly 5E1)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-ERK3 mouse monoclonal antibody, clone OTI5E1 (formerly 5E1)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |