Products

cDNA Clones (11)
Proteins (7)
Antibodies (2)
Jump to Filters
View as table Download
GDF 5 (GDF5) (NM_000557) Human Tagged ORF Clone
RC207105

USD 420.00

In Stock

GDF5 (Myc-DDK-tagged)-Human growth differentiation factor 5 (GDF5)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GDF 5 (GDF5) (NM_000557) Human Tagged ORF Clone
RG207105

USD 460.00

In Stock

GDF5 (GFP-tagged) - Human growth differentiation factor 5 (GDF5)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GDF 5 (GDF5) (NM_000557) Human Tagged ORF Clone
RC207105L3

USD 620.00

3 Weeks

Lenti ORF clone of Human growth differentiation factor 5 (GDF5), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GDF 5 (GDF5) (NM_000557) Human Tagged ORF Clone
RC207105L4

USD 620.00

3 Weeks

Lenti ORF clone of Human growth differentiation factor 5 (GDF5), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GDF 5 (GDF5) (NM_000557) Human Untagged Clone
SC125956

USD 310.00

In Stock

GDF5 (untagged)-Human growth differentiation factor 5 (GDF5)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
GDF 5 (GDF5) (NM_000557) Human Over-expression Lysate
LY424647

USD 396.00

In Stock

Transient overexpression lysate of growth differentiation factor 5 (GDF5)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GDF 5 (GDF5) (NM_000557) Human Tagged ORF Clone
RC207105L2

USD 620.00

3 Weeks

Lenti ORF clone of Human growth differentiation factor 5 (GDF5), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
GDF 5 (GDF5) (C-term) Rabbit Polyclonal Antibody
AP51811PU-N

USD 450.00

2 Weeks

GDF 5 (GDF5) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen conjugated synthetic peptide between 350-379 amino acids from the C-terminal region of human BMP14 / GDF5
GDF 5 (GDF5) Rabbit Polyclonal Antibody
TA343293

USD 375.00

5 Days

Rabbit Polyclonal Anti-GDF5 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GDF5 antibody is: synthetic peptide directed towards the C-terminal region of GDF5. Synthetic peptide located within the following region: YLFSQRRKRRAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAP
BMP14 / GDF5 (382-501, His-tag) Human Protein
AR09215PU-L

USD 845.00

2 Weeks

BMP14 / GDF5 (382-501, His-tag) human protein, 0.5 mg

Tag His-tag
Expression Host E. coli
BMP14 / GDF5 (382-501, His-tag) Human Protein
AR09215PU-N

USD 330.00

2 Weeks

BMP14 / GDF5 (382-501, His-tag) human protein, 0.1 mg

Tag His-tag
Expression Host E. coli
GDF 5 (GDF5) (NM_000557) Human Over-expression Lysate
LC424647

USD 121.00

2 Weeks

GDF5 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GDF 5 (GDF5) ICC Control Block
TB407105

USD 1,070.00

4 Weeks

Transient overexpression of GDF5 (NM_000557) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GDF 5 (GDF5) Cytosection
TS407105

USD 225.00

4 Weeks

Transient overexpression of GDF5 (NM_000557) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GDF 5 (GDF5) Cytosection
TS407105P5

USD 889.00

4 Weeks

Transient overexpression of GDF5 (NM_000557) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack