GDF5 (Myc-DDK-tagged)-Human growth differentiation factor 5 (GDF5)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GDF5 (Myc-DDK-tagged)-Human growth differentiation factor 5 (GDF5)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, GDF5 (Myc-DDK tagged) - Human growth differentiation factor 5 (GDF5), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, GDF5 (mGFP-tagged) - Human growth differentiation factor 5 (GDF5), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
GDF5 (GFP-tagged) - Human growth differentiation factor 5 (GDF5)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human growth differentiation factor 5 (GDF5), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GDF5 (Myc-DDK tagged) - Human growth differentiation factor 5 (GDF5), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human growth differentiation factor 5 (GDF5), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GDF5 (mGFP-tagged) - Human growth differentiation factor 5 (GDF5), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
GDF5 (untagged)-Human growth differentiation factor 5 (GDF5)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human growth differentiation factor 5 (GDF5), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Transient overexpression lysate of growth differentiation factor 5 (GDF5)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human growth differentiation factor 5 (GDF5), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
GDF 5 (GDF5) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | conjugated synthetic peptide between 350-379 amino acids from the C-terminal region of human BMP14 / GDF5 |
Rabbit Polyclonal Anti-GDF5 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GDF5 antibody is: synthetic peptide directed towards the C-terminal region of GDF5. Synthetic peptide located within the following region: YLFSQRRKRRAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAP |
BMP14 / GDF5 (382-501, His-tag) human protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
BMP14 / GDF5 (382-501, His-tag) human protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
GDF5 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression of GDF5 (NM_000557) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GDF5 (NM_000557) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GDF5 (NM_000557) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack