Germany
Japan
United Kingdom
China
SOX1 (Myc-DDK-tagged)-Human SRY (sex determining region Y)-box 1 (SOX1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
SOX1 (GFP-tagged) - Human SRY (sex determining region Y)-box 1 (SOX1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, SOX1 (Myc-DDK tagged) - Human SRY (sex determining region Y)-box 1 (SOX1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, SOX1 (mGFP-tagged) - Human SRY (sex determining region Y)-box 1 (SOX1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Recombinant protein of human SRY (sex determining region Y)-box 1 (SOX1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
Lenti ORF particles, SOX1 (Myc-DDK tagged) - Human SRY (sex determining region Y)-box 1 (SOX1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, SOX1 (mGFP-tagged) - Human SRY (sex determining region Y)-box 1 (SOX1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Transient overexpression lysate of SRY (sex determining region Y)-box 1 (SOX1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
SOX1 (untagged)-Human SRY (sex determining region Y)-box 1 (SOX1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human SRY (sex determining region Y)-box 1 (SOX1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human SRY (sex determining region Y)-box 1 (SOX1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human SRY (sex determining region Y)-box 1 (SOX1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human SRY (sex determining region Y)-box 1 (SOX1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
SOX1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Anti-SOX1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 378-391 amino acids of human SRY (sex determining region Y)-box 1 |
Rabbit polyclonal anti-Sox-1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to residues surrounding amino acids 322 of mouse Sox-1 |
Rabbit Polyclonal anti-SOX1 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOX1 antibody: synthetic peptide directed towards the middle region of human SOX1. Synthetic peptide located within the following region: AAGGAHQNSAVAAAAAAAAASSGALGALGSLVKSEPSGSPPAPAHSRAPC |
Rabbit Polyclonal Anti-SOX1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SOX1 Antibody: synthetic peptide directed towards the N terminal of human SOX1. Synthetic peptide located within the following region: YSMMMETDLHSPGGAQAPTNLSGPAGAGGGGGGGGGGGGGGGAKANQDRV |
Rabbit Polyclonal Anti-SOX1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SOX1 Antibody: synthetic peptide directed towards the C terminal of human SOX1. Synthetic peptide located within the following region: ALGSLVKSEPSGSPPAPAHSRAPCPGDLREMISMYLPAGEGGDPAAAAAA |
Rabbit Polyclonal Anti-SOX1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOX1 antibody: synthetic peptide directed towards the N terminal of human SOX1. Synthetic peptide located within the following region: GGGAKANQDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWK |
Rabbit Polyclonal Anti-SOX1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOX1 antibody: synthetic peptide directed towards the middle region of human SOX1. Synthetic peptide located within the following region: REMISMYLPAGEGGDPAAAAAAAAQSRLHSLPQHYQGAGAGVNGTVPLTH |
Rabbit anti SOX-1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from N-terminus of Human SOX-1 protein. This sequence is identical among human and mouse. |
SOX1 MS Standard C13 and N15-labeled recombinant protein (NP_005977)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Anti-SOX1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 378-391 amino acids of human SRY (sex determining region Y)-box 1 |
Transient overexpression of SOX1 (NM_005986) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SOX1 (NM_005986) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SOX1 (NM_005986) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- SOX1
Families
- Adult stem cells