Products

Jump to Filters
View as table Download
RAD17 Rabbit Polyclonal Antibody
TA332637

USD 275.00

3 Weeks

Rabbit anti-RAD17 Polyclonal Antibody

Applications IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human RAD17
RAD17 Rabbit Polyclonal Antibody
TA347338

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-RAD17 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-RAD17 Antibody: A synthesized peptide derived from human RAD17
RAD17 Rabbit Polyclonal Antibody
TA312462

USD 345.00

In Stock

Rabbit polyclonal RAD17 (Ab-646) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human RAD17.
RAD17 Rabbit Polyclonal Antibody
TA329132

USD 310.00

5 Days

Rabbit Polyclonal anti-RAD17 antibody

Applications WB
Reactivities Human, Mouse, Xenopus
Conjugation Unconjugated
Immunogen The immunogen for anti-RAD17 antibody: synthetic peptide directed towards the C terminal of human RAD17. Synthetic peptide located within the following region: PTQATVPETWSLPLSQNSASELPASQPQPFSAQGDMEENIIIEDYESDGT
RAD17 Rabbit Polyclonal Antibody
TA329154

USD 375.00

5 Days

Rabbit Polyclonal anti-RAD17 antibody

Applications WB
Reactivities Human, Mouse, Xenopus
Conjugation Unconjugated
Immunogen The immunogen for anti-RAD17 antibody: synthetic peptide directed towards the N terminal of human RAD17. Synthetic peptide located within the following region: MNQVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLESSRF
RAD17 Rabbit Polyclonal Antibody
TA350323

USD 345.00

In Stock

Rabbit Polyclonal Anti-RAD17 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human RAD17