Germany
Japan
United Kingdom
China
PCK1 (Myc-DDK-tagged)-Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, PCK1 (Myc-DDK tagged) - Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, PCK1 (mGFP-tagged) - Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
PCK1 (GFP-tagged) - Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PCK1 (Myc-DDK tagged) - Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, PCK1 (mGFP-tagged) - Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
PCK1 (untagged)-Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
PCK1 Rabbit Polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human PCK1 |
Transient overexpression lysate of phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Goat Polyclonal Antibody against PCK1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EKEVEDIEKYLEDQ, from the internal region (near the C Terminus) of the protein sequence according to NP_002582.2. |
Rabbit Polyclonal Anti-PCK1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the middle region of human PCK1. Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS |
PCK1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Goat Anti-PCK1 / PEPCKC (internal) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HVNWFRKDKEGK, from the internal region of the protein sequence according to NP_002582.3. |
Rabbit polyclonal anti-PEPCK-C antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surroundign amino acid 507 of mouse PEPCK-C |
Rabbit Polyclonal Anti-PCK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the N terminal of human PCK1. Synthetic peptide located within the following region: PPQLQNGLNLSAKVVQGSLDSLPQAVREFLENNAELCQPDHIHICDGSEE |
Rabbit Polyclonal Anti-PCK1 Antibody
| Applications | WB |
| Reactivities | Human, Pig |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the middle region of human PCK1. Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS |
PCK1 / PEPCK1 (1-622, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
PCK1 / PEPCK1 (1-622, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
PCK1 MS Standard C13 and N15-labeled recombinant protein (NP_002582)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Rabbit Polyclonal Anti-PCK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PCK1 |
Transient overexpression of PCK1 (NM_002591) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PCK1 (NM_002591) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PCK1 (NM_002591) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PCK1
Families
- Druggable Genome
Pathways
- Citrate cycle (TCA cycle)