GSTP1 (Myc-DDK-tagged)-Human glutathione S-transferase pi 1 (GSTP1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GSTP1 (Myc-DDK-tagged)-Human glutathione S-transferase pi 1 (GSTP1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GSTP1 (GFP-tagged) - Human glutathione S-transferase pi 1 (GSTP1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human glutathione S-transferase pi 1 (GSTP1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, GSTP1 (Myc-DDK tagged) - Human glutathione S-transferase pi 1 (GSTP1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, GSTP1 (mGFP-tagged) - Human glutathione S-transferase pi 1 (GSTP1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
GSTP1 (untagged)-Human glutathione S-transferase pi 1 (GSTP1)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF particles, GSTP1 (Myc-DDK tagged) - Human glutathione S-transferase pi 1 (GSTP1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human glutathione S-transferase pi 1 (GSTP1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GSTP1 (mGFP-tagged) - Human glutathione S-transferase pi 1 (GSTP1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit anti-GSTP1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GSTP1 |
Lenti ORF clone of Human glutathione S-transferase pi 1 (GSTP1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-GSTP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GSTP1 antibody is: synthetic peptide directed towards the N-terminal region of Human GSTP1. Synthetic peptide located within the following region: TVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQ |
Rabbit Polyclonal GSTP1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | GSTP1 antibody was raised against a 14 amino acid peptide from near the center of human GSTP1. |
Transient overexpression lysate of glutathione S-transferase pi 1 (GSTP1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GST3 (GSTP1) mouse monoclonal antibody, clone D2-62, Purified
Applications | ELISA, R, WB |
Reactivities | Human |
GST3 (GSTP1) mouse monoclonal antibody, clone D2-62, Purified
Applications | ELISA, R, WB |
Reactivities | Human |
GST3 (GSTP1) rabbit polyclonal antibody, Serum
Applications | ELISA, R, WB |
Reactivities | Human |
Immunogen | Human Glutathion S-Transferase pi |
GST3 (GSTP1) rabbit polyclonal antibody, Serum
Applications | ELISA, R, WB |
Reactivities | Human |
Immunogen | Human Glutathion S-Transferase pi |
GST3 (GSTP1) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | A peptide mapping at the C-terminus of GSTpi of human origin |
GSTP1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Lenti ORF clone of Human glutathione S-transferase pi 1 (GSTP1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal antibody to glutathione transferase (glutathione S-transferase pi 1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 63 of GSTP1 (Uniprot ID#P09211) |
Rabbit polyclonal GSTP1 Antibody (C-term)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This GSTP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 165-192 amino acids from the C-terminal region of human GSTP1. |
GST3 (GSTP1) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | GSTP1 antibody was raised against 14 amino acid peptide from near the center of human GSTP1 |
Goat Polyclonal Antibody against GST3 / GSTP1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-LADQGQSWKEEV, from the internal region of the protein sequence according to NP_000843.1. |
GSTP1 / GST3 (1-210, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
GSTP1 / GST3 (1-210, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) GSTP1 mouse monoclonal antibody, clone OTI4B6 (formerly 4B6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GSTP1 mouse monoclonal antibody, clone OTI10H1 (formerly 10H1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GSTP1 MS Standard C13 and N15-labeled recombinant protein (NP_000843)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Rabbit Polyclonal Anti-GSTP1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GSTP1 |
GSTP1 mouse monoclonal antibody, clone OTI4B6 (formerly 4B6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
GSTP1 mouse monoclonal antibody,clone 4B6, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
GSTP1 mouse monoclonal antibody,clone 4B6, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
GSTP1 mouse monoclonal antibody, clone OTI4B6 (formerly 4B6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GSTP1 mouse monoclonal antibody, clone OTI10H1 (formerly 10H1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
GSTP1 mouse monoclonal antibody,clone 10H1, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
GSTP1 mouse monoclonal antibody,clone 10H1, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
GSTP1 mouse monoclonal antibody, clone OTI10H1 (formerly 10H1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of GSTP1 (NM_000852) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GSTP1 (NM_000852) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GSTP1 (NM_000852) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack