CYP4F3 (Myc-DDK-tagged)-Human cytochrome P450, family 4, subfamily F, polypeptide 3 (CYP4F3), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
CYP4F3 (Myc-DDK-tagged)-Human cytochrome P450, family 4, subfamily F, polypeptide 3 (CYP4F3), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CYP4F3 (GFP-tagged) - Human cytochrome P450, family 4, subfamily F, polypeptide 3 (CYP4F3), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of CYP4F3 (Myc-DDK-tagged)-Human cytochrome P450, family 4, subfamily F, polypeptide 3 (CYP4F3), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CYP4F3 (Myc-DDK-tagged)-Human cytochrome P450, family 4, subfamily F, polypeptide 3 (CYP4F3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of CYP4F3 (mGFP-tagged)-Human cytochrome P450, family 4, subfamily F, polypeptide 3 (CYP4F3), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CYP4F3 (mGFP-tagged)-Human cytochrome P450, family 4, subfamily F, polypeptide 3 (CYP4F3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CYP4F3 (Myc-DDK tagged) - Homo sapiens cytochrome P450, family 4, subfamily F, polypeptide 3 (CYP4F3), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CYP4F3 (Myc-DDK tagged) - Homo sapiens cytochrome P450, family 4, subfamily F, polypeptide 3 (CYP4F3), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CYP4F3 (GFP-tagged) - Homo sapiens cytochrome P450, family 4, subfamily F, polypeptide 3 (CYP4F3), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CYP4F3 (GFP-tagged) - Homo sapiens cytochrome P450, family 4, subfamily F, polypeptide 3 (CYP4F3), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-CYP4F3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP4F3 antibody: synthetic peptide directed towards the N terminal of human CYP4F3. Synthetic peptide located within the following region: LAWTYTFYDNCCRLRCFPQPPKRNWFLGHLGLIHSSEEGLLYTQSLACTF |
CYP4F3 (untagged)-Human cytochrome P450, family 4, subfamily F, polypeptide 3 (CYP4F3), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
CYP4F3 (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human CYP4F3 |
CYP4F3 (untagged) - Homo sapiens cytochrome P450, family 4, subfamily F, polypeptide 3 (CYP4F3), transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
CYP4F3 (untagged) - Homo sapiens cytochrome P450, family 4, subfamily F, polypeptide 3 (CYP4F3), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
Transient overexpression of CYP4F3 (NM_000896) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CYP4F3 (NM_001199208) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CYP4F3 (NM_001199209) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CYP4F3 (NM_000896) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CYP4F3 (NM_000896) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CYP4F3 (NM_001199208) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CYP4F3 (NM_001199209) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack