Germany
Japan
United Kingdom
China
NR1H3 (Myc-DDK-tagged)-Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 820.00
3 Weeks
Lenti ORF particles, NR1H3 (Myc-DDK tagged) - Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, NR1H3 (mGFP-tagged) - Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
NR1H3 (GFP-tagged) - Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 820.00
3 Weeks
Lenti ORF particles, NR1H3 (mGFP-tagged) - Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, NR1H3 (Myc-DDK tagged) - Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
NR1H3 (Myc-DDK-tagged)-Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of NR1H3 (Myc-DDK-tagged)-Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, NR1H3 (Myc-DDK-tagged)-Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of NR1H3 (mGFP-tagged)-Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, NR1H3 (mGFP-tagged)-Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
NR1H3 (Myc-DDK-tagged)-Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of NR1H3 (Myc-DDK-tagged)-Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 3
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
11 Weeks
Lenti ORF particles, NR1H3 (Myc-DDK-tagged)-Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of NR1H3 (mGFP-tagged)-Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 3
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
11 Weeks
Lenti ORF particles, NR1H3 (mGFP-tagged)-Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
NR1H3 (Myc-DDK tagged) - Homo sapiens nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NR1H3 (Myc-DDK tagged) - Homo sapiens nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NR1H3 (GFP-tagged) - Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NR1H3 (GFP-tagged) - Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NR1H3 (GFP-tagged) - Homo sapiens nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NR1H3 (GFP-tagged) - Homo sapiens nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NR1H3 (untagged)-Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SC116564 is the updated version of SC116563.
Lenti ORF clone of Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal NR1H3 Antibody (Center)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NR1H3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 226-253 amino acids from the Central region of human NR1H3. |
Rabbit anti-NR1H3 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human NR1H3 |
Lenti ORF clone of Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
NR1H3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Goat Polyclonal Antibody against NR1H3; NR1H2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CRLQDKKLPPLLSEI, from the internal region of the protein sequence according to NP_005684; NP_009052. |
Rabbit Polyclonal Anti-NR1H3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1H3 antibody: synthetic peptide directed towards the N terminal of human NR1H3. Synthetic peptide located within the following region: MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSA |
LXR alpha (NR1H3) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of human LXRα, identical to the related rat and mouse sequence. |
Rabbit Polyclonal Antibody against Liver X Receptor
| Applications | WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human LXR protein sequence (between residues 50-150). |
Anti-NR1H3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 50-330 amino acids of human nuclear receptor subfamily 1, group H, member 3 |
Rabbit Polyclonal Anti-NR1H3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1H3 antibody: synthetic peptide directed towards the C terminal of human NR1H3. Synthetic peptide located within the following region: IHHPHDRLMFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWD |
Carrier-free (BSA/glycerol-free) NR1H3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Transient overexpression lysate of nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
NR1H3 MS Standard C13 and N15-labeled recombinant protein (NP_005684)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
NR1H3 (untagged)-Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
NR1H3 (untagged)-Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
NR1H3 (untagged) - Homo sapiens nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 4
| Vector | pCMV6 series |
| Tag | Tag Free |
NR1H3 (untagged) - Homo sapiens nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 5
| Vector | pCMV6 series |
| Tag | Tag Free |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- NR1H3
Families
- Druggable Genome
Pathways
- PPAR signaling pathway