Products

View as table Download

Rabbit Polyclonal Anti-PROC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PROC antibody: synthetic peptide directed towards the middle region of human PROC. Synthetic peptide located within the following region: PCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLD

Rabbit anti-PROC Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PROC

Rabbit Polyclonal Anti-PROC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PROC antibody: synthetic peptide directed towards the N terminal of human PROC. Synthetic peptide located within the following region: MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEEL

Protein C (PROC) mouse monoclonal antibody, clone HLW-C, Aff - Purified

Applications ELISA
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal antibody to Protein C (protein C (inactivator of coagulation factors Va and VIIIa))

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 145 and 461 of Protein C (Uniprot ID#P04070)

Rabbit polyclonal PROC (light chain, Cleaved-Leu179) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human PROC.

PROC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated