Products

cDNA Clones (22)
Proteins (11)
Antibodies (5)
Jump to Filters
View as table Download
ABCE1 (NM_001040876) Human Tagged ORF Clone
RC201981

USD 420.00

In Stock

ABCE1 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ABCE1 (NM_002940) Human Tagged ORF Clone
RC223295

USD 420.00

In Stock

ABCE1 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ABCE1 (NM_001040876) Human Tagged ORF Clone Lentiviral Particle
RC201981L1V

USD 820.00

3 Weeks

Lenti ORF particles, ABCE1 (Myc-DDK tagged) - Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
ABCE1 (NM_001040876) Human Tagged ORF Clone Lentiviral Particle
RC201981L2V

USD 820.00

6 Weeks

Lenti ORF particles, ABCE1 (mGFP-tagged) - Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
ABCE1 (NM_002940) Human Tagged ORF Clone Lentiviral Particle
RC223295L1V

USD 820.00

3 Weeks

Lenti ORF particles, ABCE1 (Myc-DDK tagged) - Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
ABCE1 (NM_002940) Human Tagged ORF Clone Lentiviral Particle
RC223295L2V

USD 820.00

3 Weeks

Lenti ORF particles, ABCE1 (mGFP-tagged) - Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
ABCE1 (NM_001040876) Human Tagged ORF Clone
RG201981

USD 460.00

In Stock

ABCE1 (GFP-tagged) - Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ABCE1 (NM_002940) Human Tagged ORF Clone
RG223295

USD 460.00

In Stock

ABCE1 (GFP-tagged) - Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ABCE1 (NM_001040876) Human Tagged ORF Clone
RC201981L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCE1 (NM_001040876) Human Tagged ORF Clone Lentiviral Particle
RC201981L3V

USD 820.00

5 Weeks

Lenti ORF particles, ABCE1 (Myc-DDK tagged) - Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCE1 (NM_001040876) Human Tagged ORF Clone
RC201981L4

USD 620.00

3 Weeks

Lenti ORF clone of Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCE1 (NM_001040876) Human Tagged ORF Clone Lentiviral Particle
RC201981L4V

USD 820.00

7 Weeks

Lenti ORF particles, ABCE1 (mGFP-tagged) - Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCE1 (NM_002940) Human Tagged ORF Clone
RC223295L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCE1 (NM_002940) Human Tagged ORF Clone Lentiviral Particle
RC223295L3V

USD 820.00

7 Weeks

Lenti ORF particles, ABCE1 (Myc-DDK tagged) - Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCE1 (NM_002940) Human Tagged ORF Clone
RC223295L4

USD 620.00

3 Weeks

Lenti ORF clone of Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCE1 (NM_002940) Human Tagged ORF Clone Lentiviral Particle
RC223295L4V

USD 820.00

5 Weeks

Lenti ORF particles, ABCE1 (mGFP-tagged) - Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCE1 (NM_001040876) Human Tagged Lenti ORF Clone
RC201981L1

USD 768.00

In Stock

Lenti ORF clone of Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
ABCE1 (NM_002940) Human Tagged Lenti ORF Clone
RC223295L2

USD 768.00

In Stock

Lenti ORF clone of Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
ABCE1 (NM_002940) Human Untagged Clone
SC118287

USD 310.00

In Stock

ABCE1 (untagged)-Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ABCE1 (NM_001040876) Human Tagged ORF Clone
RC201981L2

USD 620.00

3 Weeks

Lenti ORF clone of Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
ABCE1 (NM_002940) Human Tagged ORF Clone
RC223295L1

USD 620.00

In Stock

Lenti ORF clone of Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
ABCE1 (NM_002940) Human Over-expression Lysate
LC401029

USD 121.00

In Stock

ABCE1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
ABCE1 (NM_001040876) Human Over-expression Lysate
LC420840

USD 121.00

In Stock

ABCE1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ABCE1 (NM_002940) Human Over-expression Lysate
LY401029

USD 396.00

5 Days

Transient overexpression lysate of ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ABCE1 (NM_001040876) Human Over-expression Lysate
LY420840

USD 396.00

In Stock

Transient overexpression lysate of ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ABCE1 (NM_001040876) Human Untagged Clone
SC323716

USD 760.00

In Stock

ABCE1 (untagged)-Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
ABCE1 Rabbit Polyclonal Antibody
TA301458

USD 424.00

5 Days

Rabbit Polyclonal Antibody against ABCE1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A fusion protein containing amino acids 1-119 of the ABCE1 protein.
ABCE1 Goat Polyclonal Antibody
TA302402

USD 375.00

5 Days

Goat Polyclonal Antibody against ABCE1/ RNAse L inhibitor

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KLNSIKDVEQKK, from the C Terminus of the protein sequence according to NP_002931.1.
ABCE1 Rabbit Polyclonal Antibody
TA332231

USD 375.00

5 Days

Rabbit Polyclonal Anti-ABCE1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCE1 Antibody: synthetic peptide directed towards the C terminal of human ABCE1. Synthetic peptide located within the following region: LAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD
ABCE1 (NM_002940) Human Mass Spec Standard
PH323295

USD 2,055.00

3 Weeks

ABCE1 MS Standard C13 and N15-labeled recombinant protein (NP_002931)

Tag C-Myc/DDK
Expression Host HEK293
ABCE1 Rabbit Polyclonal Antibody
TA323290

USD 345.00

In Stock

Anti-ABCE1 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 345-562 amino acids of human ATP-binding cassette, sub-family E (OABP), member 1
ABCE1 Rabbit Polyclonal Antibody
TA323291

USD 345.00

In Stock

Anti-ABCE1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 345-562 amino acids of human ATP-binding cassette, sub-family E (OABP), member 1
ABCE1 ICC Control Block
TB401981

USD 1,070.00

4 Weeks

Transient overexpression of ABCE1 (NM_001040876) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ABCE1 ICC Control Block
TB423295

USD 1,070.00

4 Weeks

Transient overexpression of ABCE1 (NM_002940) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ABCE1 Cytosection
TS401981

USD 225.00

4 Weeks

Transient overexpression of ABCE1 (NM_001040876) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ABCE1 Cytosection
TS401981P5

USD 889.00

4 Weeks

Transient overexpression of ABCE1 (NM_001040876) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ABCE1 Cytosection
TS423295

USD 225.00

4 Weeks

Transient overexpression of ABCE1 (NM_002940) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ABCE1 Cytosection
TS423295P5

USD 889.00

4 Weeks

Transient overexpression of ABCE1 (NM_002940) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack