Germany
Japan
United Kingdom
China
ABCE1 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
ABCE1 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Lenti ORF particles, ABCE1 (Myc-DDK tagged) - Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, ABCE1 (mGFP-tagged) - Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, ABCE1 (Myc-DDK tagged) - Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, ABCE1 (mGFP-tagged) - Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Abce1 (Myc-DDK-tagged) - Mouse ATP-binding cassette, sub-family E (OABP), member 1 (Abce1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ABCE1 (GFP-tagged) - Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ABCE1 (GFP-tagged) - Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ABCE1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN401981 is the updated version of KN201981.
Abce1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN500635 is the updated version of KN300635.
Abce1 (GFP-tagged) - Mouse ATP-binding cassette, sub-family E (OABP), member 1 (Abce1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Abce1 (Myc-DDK-tagged) - Mouse ATP-binding cassette, sub-family E (OABP), member 1 (Abce1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Abce1 (Myc-DDK-tagged) - Mouse ATP-binding cassette, sub-family E (OABP), member 1 (Abce1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Abce1 (mGFP-tagged) - Mouse ATP-binding cassette, sub-family E (OABP), member 1 (Abce1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Abce1 (GFP-tagged) - Mouse ATP-binding cassette, sub-family E (OABP), member 1 (Abce1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ABCE1 (Myc-DDK tagged) - Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ABCE1 (mGFP-tagged) - Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ABCE1 (Myc-DDK tagged) - Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ABCE1 (mGFP-tagged) - Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Abce1 (Myc-DDK-tagged ORF) - Rat ATP-binding cassette, sub-family E (OABP), member 1 (Abce1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Abce1 (Myc-DDK-tagged ORF) - Rat ATP-binding cassette, sub-family E (OABP), member 1 (Abce1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Abce1 (Myc-DDK-tagged ORF) - Rat ATP-binding cassette, sub-family E (OABP), member 1 (Abce1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Abce1 (mGFP-tagged ORF) - Rat ATP-binding cassette, sub-family E (OABP), member 1 (Abce1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Abce1 (GFP-tagged ORF) - Rat ATP-binding cassette, sub-family E (OABP), member 1 (Abce1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
ABCE1 (untagged)-Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
ABCE1 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
ABCE1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
ABCE1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
ABCE1 (untagged)-Human ATP-binding cassette, sub-family E (OABP), member 1 (ABCE1), transcript variant 2
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Goat Polyclonal Antibody against ABCE1/ RNAse L inhibitor
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KLNSIKDVEQKK, from the C Terminus of the protein sequence according to NP_002931.1. |
Rabbit Polyclonal Anti-ABCE1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ABCE1 Antibody: synthetic peptide directed towards the C terminal of human ABCE1. Synthetic peptide located within the following region: LAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD |
ABCE1 CRISPRa kit - CRISPR gene activation of human ATP binding cassette subfamily E member 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Abce1 CRISPRa kit - CRISPR gene activation of mouse ATP-binding cassette, sub-family E (OABP), member 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene ABCE1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene ABCE1
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Abce1 (untagged) - Mouse ATP-binding cassette, sub-family E (OABP), member 1 (Abce1), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Abce1
ABCE1 MS Standard C13 and N15-labeled recombinant protein (NP_002931)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Active filters
Target Symbol
- ABCE1