Products

cDNA Clones (10)
Antibodies (5)
Proteins (5)
Jump to Filters
View as table Download
Aquaporin 2 (AQP2) (NM_000486) Human Tagged ORF Clone
RC206553

USD 420.00

In Stock

AQP2 (Myc-DDK-tagged)-Human aquaporin 2 (collecting duct) (AQP2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Aquaporin 2 (AQP2) (NM_000486) Human Tagged ORF Clone
RG206553

USD 460.00

In Stock

AQP2 (GFP-tagged) - Human aquaporin 2 (collecting duct) (AQP2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Aquaporin 2 (AQP2) (NM_000486) Human Tagged ORF Clone
RC206553L4

USD 620.00

3 Weeks

Lenti ORF clone of Human aquaporin 2 (collecting duct) (AQP2), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Aquaporin 2 (AQP2) (NM_000486) Human Untagged Clone
SC300078

USD 660.00

In Stock

AQP2 (untagged)-Human aquaporin 2 (collecting duct) (AQP2)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Aquaporin 2 (AQP2) Rabbit Polyclonal Antibody
TA335241

USD 375.00

In Stock

Rabbit Polyclonal Anti-Aqp2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Aqp2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ALSIGFSVTLGHLLGIYFTGCSMNPARSLAPAVVTGKFDDHWVFWIGPLV
Aquaporin 2 (AQP2) Rabbit Polyclonal Antibody
TA309574

USD 457.00

2 Weeks

Rabbit Polyclonal Aquaporin-2 Antibody

Applications WB
Reactivities Bovine, Human, Mouse, Porcine, Rat, Sheep
Conjugation Unconjugated
Immunogen Synthetic peptide made to a C-terminus portion of the rat protein (within residues 200-300). [Swiss-Prot# P34080]
Aquaporin 2 (AQP2) (NM_000486) Human Over-expression Lysate
LC424696

USD 121.00

In Stock

AQP2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Aquaporin 2 (AQP2) (NM_000486) Human Tagged ORF Clone
RC206553L2

USD 620.00

3 Weeks

Lenti ORF clone of Human aquaporin 2 (collecting duct) (AQP2), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Aquaporin 2 (AQP2) Rabbit Polyclonal Antibody
TA326697

USD 430.00

5 Days

Rabbit Polyclonal AQP2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen AQP2 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human AQP2.
Aquaporin 2 (AQP2) Rabbit Polyclonal Antibody
TA323647

USD 345.00

In Stock

Anti-AQP2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 255-271 amino acids of Human Aquaporin-2
Aquaporin 2 (AQP2) Rabbit Polyclonal Antibody
TA323648

USD 345.00

In Stock

Anti-AQP2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 255-271 amino acids of Human Aquaporin-2
Aquaporin 2 (AQP2) ICC Control Block
TB406553

USD 1,070.00

4 Weeks

Transient overexpression of AQP2 (NM_000486) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Aquaporin 2 (AQP2) Cytosection
TS406553

USD 225.00

4 Weeks

Transient overexpression of AQP2 (NM_000486) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Aquaporin 2 (AQP2) Cytosection
TS406553P5

USD 889.00

4 Weeks

Transient overexpression of AQP2 (NM_000486) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack