Products

View as table Download

ATP2A1 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant a

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF clone of Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant a, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ATP2A1 (Myc-DDK tagged) - Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant a, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant a, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ATP2A1 (mGFP-tagged) - Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant a, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ATP2A1 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant b

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of ATP2A1 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant b

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ATP2A1 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant b, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of ATP2A1 (mGFP-tagged)-Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant b

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ATP2A1 (mGFP-tagged)-Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant b, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ATP2A1 (myc-DDK-tagged) - Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant c

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

ATP2A1 (GFP-tagged) - Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant a

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ATP2A1 (GFP-tagged) - Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant b

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit Polyclonal Anti-ATP2A1 Antibody

Applications IHC, WB
Reactivities Human, Macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP2A1 antibody: synthetic peptide directed towards the N terminal of human ATP2A1. Synthetic peptide located within the following region: MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLW

Transient overexpression lysate of ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant a

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

ATP2A1 (522-613) mouse monoclonal antibody, clone 1B11, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human

Rabbit Polyclonal Anti-ATP2A1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ATP2A1

ATP2A1 (untagged)-Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant a

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit polyclonal anti-ATP2A1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ATP2A1.

ATP2A1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

ATP2A1 MS Standard C13 and N15-labeled recombinant protein (NP_775293)

Tag C-Myc/DDK
Expression Host HEK293

ATP2A1 (GFP-tagged) - Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant c

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ATP2A1 (untagged)-Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant b

Vector pCMV6 series
Tag Tag Free

ATP2A1 (untagged) - Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant c

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Transient overexpression of ATP2A1 (NM_173201) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of ATP2A1 (NM_004320) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of ATP2A1 (NM_001286075) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of ATP2A1 (NM_173201) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of ATP2A1 (NM_173201) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of ATP2A1 (NM_004320) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of ATP2A1 (NM_001286075) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack