CCNH (Myc-DDK-tagged)-Human cyclin H (CCNH), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CCNH (Myc-DDK-tagged)-Human cyclin H (CCNH), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human cyclin H (CCNH)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
CCNH (GFP-tagged) - Human cyclin H (CCNH), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human cyclin H (CCNH), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, CCNH (Myc-DDK tagged) - Human cyclin H (CCNH), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cyclin H (CCNH), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, CCNH (mGFP-tagged) - Human cyclin H (CCNH), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CCNH (myc-DDK-tagged) - Human cyclin H (CCNH), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CCNH (untagged)-Human cyclin H (CCNH), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal Cyclin H (Ab-315) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Cyclin H around the phosphorylation site of threonine 315 (E-W-TP-D-D). |
CCNH Rabbit Polyclonal Antibody
Applications | IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CCNH |
Cyclin H (CCNH) mouse monoclonal antibody, clone 1B8, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-Cyclin H Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Cyclin H Antibody: A synthesized peptide derived from human Cyclin H |
Rabbit polyclonal Cyclin H (Thr315) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Cyclin H around the phosphorylation site of threonine 315 (E-W-TP-D-D) |
Modifications | Phospho-specific |
Cyclin H mouse monoclonal antibody, clone AT3G6, Purified
Applications | ELISA, WB |
Reactivities | Human |
Cyclin H mouse monoclonal antibody, clone AT3G6, Purified
Applications | ELISA, WB |
Reactivities | Human |
Cyclin H (CCNH) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 267-299 amino acids from the C-terminal region of human CCNH |
Cyclin H (CCNH) (N-term) rabbit polyclonal antibody, Purified
Applications | FC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 31-60 amino acids from the N-terminal region of human CCNH |
CCNH HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-CCNH Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CCNH antibody: synthetic peptide directed towards the C terminal of human CCNH. Synthetic peptide located within the following region: KQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL |
Cyclin H (CCNH) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal anti-CCNH antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CCNH antibody: synthetic peptide directed towards the N terminal of human CCNH. Synthetic peptide located within the following region: PHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEY |
Rabbit Polyclonal Anti-CCNH Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CCNH antibody: synthetic peptide directed towards the middle region of human CCNH. Synthetic peptide located within the following region: KQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL |
Cyclin H (1-323, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
Cyclin H (1-323, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
Transient overexpression lysate of cyclin H (CCNH)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CCNH MS Standard C13 and N15-labeled recombinant protein (NP_001230)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
CCNH (GFP-tagged) - Human cyclin H (CCNH), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CCNH (untagged) - Human cyclin H (CCNH), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of CCNH (NM_001239) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CCNH (NM_001199189) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CCNH (NM_001239) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CCNH (NM_001239) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CCNH (NM_001199189) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack