CCR4 (Myc-DDK-tagged)-Human chemokine (C-C motif) receptor 4 (CCR4)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CCR4 (Myc-DDK-tagged)-Human chemokine (C-C motif) receptor 4 (CCR4)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CCR4 (untagged)-Human chemokine (C-C motif) receptor 4 (CCR4)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, CCR4 (Myc-DDK tagged) - Human chemokine (C-C motif) receptor 4 (CCR4), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, CCR4 (mGFP-tagged) - Human chemokine (C-C motif) receptor 4 (CCR4), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF clone of Human chemokine (C-C motif) receptor 4 (CCR4), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human chemokine (C-C motif) receptor 4 (CCR4), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CCR4 (GFP-tagged) - Human chemokine (C-C motif) receptor 4 (CCR4)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, CCR4 (Myc-DDK tagged) - Human chemokine (C-C motif) receptor 4 (CCR4), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CCR4 (mGFP-tagged) - Human chemokine (C-C motif) receptor 4 (CCR4), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human chemokine (C-C motif) receptor 4 (CCR4), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
CCR4 mouse monoclonal antibody, clone KH-4F5, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
CCR4 (Extracell. Dom.) goat polyclonal antibody, Aff - Purified
Applications | ELISA, FC, IHC, WB |
Reactivities | Human, Monkey |
Immunogen | Synthetic corresponding to Human CCR4 extracellular domain. Epitope: Extracellular Domain. |
Lenti ORF clone of Human chemokine (C-C motif) receptor 4 (CCR4), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Transient overexpression lysate of chemokine (C-C motif) receptor 4 (CCR4)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CCR4 Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Gibbon, Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | CCR4 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human CCR4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Panda, Dog (94%); Hamster, Elephant, Bovine, Horse (89%); Bat, Rabbit, Opossum (83%). |
Rabbit Polyclonal Anti-CCR4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CCR4 antibody: synthetic peptide directed towards the middle region of human CCR4. Synthetic peptide located within the following region: TERNHTYCKTKYSLNSTTWKVLSSLEINILGLVIPLGIMLFCYSMIIRTL |
CCR4 Rabbit Polyclonal (Extracellular Domain) Antibody
Applications | IHC |
Reactivities | Human, Monkey, Gorilla, Gibbon |
Conjugation | Unconjugated |
Immunogen | CCR4 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human CCR4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Ferret, Elephant, Panda (94%); Dog, Bovine, Bat, Hamster (89%); Mouse, Rat (83%). |
CCR4 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Mouse anti-CCR4 monoclonal antibody
Applications | IF |
Reactivities | Human |
Conjugation | Unconjugated |
CCR4 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Canine, Human, Mouse |
Immunogen | Synthetic peptide surrounding amino acid 32 of human CCR4 |
Transient overexpression of CCR4 (NM_005508) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CCR4 (NM_005508) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CCR4 (NM_005508) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack