Lenti ORF particles, CDC20 (mGFP-tagged) - Human cell division cycle 20 homolog (S. cerevisiae) (CDC20), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CDC20 (mGFP-tagged) - Human cell division cycle 20 homolog (S. cerevisiae) (CDC20), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CDC20 (Myc-DDK-tagged)-Human cell division cycle 20 homolog (S. cerevisiae) (CDC20)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human cell division cycle 20 homolog (S. cerevisiae) (CDC20)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, CDC20 (Myc-DDK tagged) - Human cell division cycle 20 homolog (S. cerevisiae) (CDC20), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, CDC20 (mGFP-tagged) - Human cell division cycle 20 homolog (S. cerevisiae) (CDC20), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF clone of Human cell division cycle 20 homolog (S. cerevisiae) (CDC20), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CDC20 (Myc-DDK tagged) - Human cell division cycle 20 homolog (S. cerevisiae) (CDC20), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cell division cycle 20 homolog (S. cerevisiae) (CDC20), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CDC20 (GFP-tagged) - Human cell division cycle 20 homolog (S. cerevisiae) (CDC20)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human cell division cycle 20 homolog (S. cerevisiae) (CDC20), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human cell division cycle 20 homolog (S. cerevisiae) (CDC20), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit anti-CDC20 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CDC20 |
CDC20 (untagged)-Human cell division cycle 20 homolog (S. cerevisiae) (CDC20)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
CDC20 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
CDC20 (untagged)-Human cell division cycle 20 homolog (S. cerevisiae) (CDC20)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit polyclonal anti-CDC20 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CDC20. |
Transient overexpression lysate of cell division cycle 20 homolog (S. cerevisiae) (CDC20)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-CDC20 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDC20 antibody: synthetic peptide directed towards the N terminal of human CDC20. Synthetic peptide located within the following region: MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSH |
Mouse monoclonal Anti-Phospho-cdc20 (Ser50) Clone BM8.1
Reactivities | Frog, Mammalian |
Conjugation | Unconjugated |
CDC20 MS Standard C13 and N15-labeled recombinant protein (NP_001246)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Anti-CDC20 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 182-480 amino acids of Human Cell division cycle protein 20 homolog |
Anti-CDC20 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 182-480 amino acids of Human Cell division cycle protein 20 homolog |
Transient overexpression of CDC20 (NM_001255) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CDC20 (NM_001255) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CDC20 (NM_001255) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack