CLCN1 (Myc-DDK-tagged)-Human chloride channel 1, skeletal muscle (CLCN1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CLCN1 (Myc-DDK-tagged)-Human chloride channel 1, skeletal muscle (CLCN1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, CLCN1 (Myc-DDK tagged) - Human chloride channel 1, skeletal muscle (CLCN1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, CLCN1 (mGFP-tagged) - Human chloride channel 1, skeletal muscle (CLCN1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF clone of Human chloride channel 1, skeletal muscle (CLCN1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CLCN1 (Myc-DDK tagged) - Human chloride channel 1, skeletal muscle (CLCN1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human chloride channel 1, skeletal muscle (CLCN1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CLCN1 (mGFP-tagged) - Human chloride channel 1, skeletal muscle (CLCN1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CLCN1 (GFP-tagged) - Human chloride channel 1, skeletal muscle (CLCN1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human chloride channel 1, skeletal muscle (CLCN1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Transient overexpression lysate of chloride channel 1, skeletal muscle (CLCN1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
CLCN1 (untagged)-Human chloride channel 1, skeletal muscle (CLCN1)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit anti-CLCN1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CLCN1 |
Lenti ORF clone of Human chloride channel 1, skeletal muscle (CLCN1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
CLCN1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-Clcn1 Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Clcn1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: SSIFQRLLHCLLGKAHSTKKKITQDSTDLVDNMSPEEIEAWEREQLSQPV |
Transient overexpression of CLCN1 (NM_000083) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CLCN1 (NM_000083) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CLCN1 (NM_000083) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack