Products

Proteins (7)
cDNA Clones (7)
Antibodies (3)
Jump to Filters
View as table Download
CXXC4 (NM_025212) Human Tagged ORF Clone
RC212834

USD 98.00

USD 390.00

In Stock

CXXC4 (Myc-DDK-tagged)-Human CXXC finger protein 4 (CXXC4)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CXXC4 (NM_025212) Human Tagged ORF Clone
RG212834

USD 460.00

In Stock

CXXC4 (GFP-tagged) - Human CXXC finger protein 4 (CXXC4)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CXXC4 (NM_025212) Human Tagged ORF Clone
RC212834L3

USD 620.00

3 Weeks

Lenti ORF clone of Human CXXC finger protein 4 (CXXC4), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CXXC4 (NM_025212) Human Tagged ORF Clone
RC212834L4

USD 620.00

3 Weeks

Lenti ORF clone of Human CXXC finger protein 4 (CXXC4), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CXXC4 Rabbit Polyclonal Antibody
TA320030

USD 430.00

In Stock

Rabbit Polyclonal CXXC4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen CXXC4 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human CXXC4.
CXXC4 (C-term) Rabbit Polyclonal Antibody
AP51153PU-N

USD 450.00

2 Weeks

CXXC4 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 164-194aa) of human CXXC4.
CXXC4 (NM_025212) Human Over-expression Lysate
LY410836

USD 396.00

In Stock

Transient overexpression lysate of CXXC finger 4 (CXXC4)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CXXC4 (NM_025212) Human Untagged Clone
SC305244

USD 420.00

In Stock

CXXC4 (untagged)-Human CXXC finger protein 4 (CXXC4)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CXXC4 (NM_025212) Human Over-expression Lysate
LC410836

USD 121.00

In Stock

CXXC4 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CXXC4 Rabbit Polyclonal Antibody
TA337976

USD 375.00

5 Days

Rabbit Polyclonal Anti-CXXC4 Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-CXXC4 antibody is: synthetic peptide directed towards the C-terminal region of Human CXXC4. Synthetic peptide located within the following region: GGAGGANPAKKKRKRCGVCVPCKRLINCGVCSSCRNRKTGHQICKFRKCE
CXXC4 (NM_025212) Human Recombinant Protein
TP760237

USD 215.00

In Stock

Recombinant protein of human CXXC finger protein 4 (CXXC4), with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
CXXC4 (NM_025212) Human Recombinant Protein
TP761593

USD 215.00

In Stock

Purified recombinant protein of Human CXXC finger protein 4 (CXXC4), full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug

Tag N-GST and C-His
Expression Host E. coli
CXXC4 (NM_025212) ICC Control Block
TB412834

USD 1,040.00

4 Weeks

Transient overexpression of CXXC4 (NM_025212) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CXXC4 Cytosection
TS412834

USD 225.00

4 Weeks

Transient overexpression of CXXC4 (NM_025212) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CXXC4 Cytosection
TS412834P5

USD 889.00

4 Weeks

Transient overexpression of CXXC4 (NM_025212) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack