DNASE1 (Myc-DDK-tagged)-Human deoxyribonuclease I (DNASE1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
DNASE1 (Myc-DDK-tagged)-Human deoxyribonuclease I (DNASE1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
DNASE1 (GFP-tagged) - Human deoxyribonuclease I (DNASE1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, DNASE1 (Myc-DDK tagged) - Human deoxyribonuclease I (DNASE1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, DNASE1 (mGFP-tagged) - Human deoxyribonuclease I (DNASE1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF clone of Human deoxyribonuclease I (DNASE1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, DNASE1 (Myc-DDK tagged) - Human deoxyribonuclease I (DNASE1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human deoxyribonuclease I (DNASE1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, DNASE1 (mGFP-tagged) - Human deoxyribonuclease I (DNASE1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
DNase I (DNASE1) (1-252) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 1 and 252 of DNase I. |
Lenti ORF clone of Human deoxyribonuclease I (DNASE1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
DNASE1 (untagged)-Human deoxyribonuclease I (DNASE1)
Vector | pCMV6-XL6 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression lysate of deoxyribonuclease I (DNASE1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal antibody to DNase I (deoxyribonuclease I)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 282 of DNase I (Uniprot ID#P24855) |
DNASE1 (untagged)-Human deoxyribonuclease I (DNASE1)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Purified recombinant protein of Human deoxyribonuclease I (DNASE1), full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug
Tag | N-GST and C-His |
Expression Host | E. coli |
Lenti ORF clone of Human deoxyribonuclease I (DNASE1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
DNASE1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Rabbit Polyclonal Anti-DNASE1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DNASE1 antibody: synthetic peptide directed towards the N terminal of human DNASE1. Synthetic peptide located within the following region: GKLLDNLNQDAPDTYHYVVSEPLGRNSYKERYLFVYRPDQVSAVDSYYYD |
Rabbit Polyclonal Anti-DNASE1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DNASE1 |
Transient overexpression of DNASE1 (NM_005223) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of DNASE1 (NM_005223) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of DNASE1 (NM_005223) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack