Products

cDNA Clones (26)
RNAi (12)
Antibodies (7)
Gene Expression (7)
Proteins (6)
Jump to Filters
View as table Download
DNase I (DNASE1) (NM_005223) Human Tagged ORF Clone
RC205927

USD 420.00

In Stock

DNASE1 (Myc-DDK-tagged)-Human deoxyribonuclease I (DNASE1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
DNase I (DNASE1) (NM_005223) Human Tagged ORF Clone
RG205927

USD 460.00

In Stock

DNASE1 (GFP-tagged) - Human deoxyribonuclease I (DNASE1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Dnase1 (NM_010061) Mouse Tagged ORF Clone
MR203857

USD 68.00

USD 149.00

In Stock

Dnase1 (Myc-DDK-tagged) - Mouse deoxyribonuclease I (Dnase1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Dnase1 Mouse Gene Knockout Kit (CRISPR)
KN504708

USD 1,290.00

2 Weeks

Dnase1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN504708 is the updated version of KN304708.
Dnase1 (NM_010061) Mouse Tagged ORF Clone
MG203857

USD 300.00

3 Weeks

Dnase1 (GFP-tagged) - Mouse deoxyribonuclease I (Dnase1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Dnase1 (NM_010061) Mouse Tagged ORF Clone
MR203857L3

USD 500.00

3 Weeks

Lenti ORF clone of Dnase1 (Myc-DDK-tagged) - Mouse deoxyribonuclease I (Dnase1)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Dnase1 (NM_010061) Mouse Tagged ORF Clone
MR203857L4

USD 500.00

3 Weeks

Lenti ORF clone of Dnase1 (mGFP-tagged) - Mouse deoxyribonuclease I (Dnase1)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DNase I (DNASE1) (NM_005223) Human Tagged ORF Clone
RC205927L4

USD 620.00

3 Weeks

Lenti ORF clone of Human deoxyribonuclease I (DNASE1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Dnase1 (NM_013097) Rat Tagged ORF Clone
RR205654

USD 420.00

4 Weeks

Dnase1 (Myc-DDK-tagged ORF) - Rat deoxyribonuclease I (Dnase1), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Dnase1 (NM_013097) Rat Tagged ORF Clone
RR205654L3

USD 640.00

8 Weeks

Lenti ORF clone of Dnase1 (Myc-DDK-tagged ORF) - Rat deoxyribonuclease I (Dnase1), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Dnase1 (NM_013097) Rat Tagged ORF Clone
RR205654L4

USD 700.00

8 Weeks

Lenti ORF clone of Dnase1 (mGFP-tagged ORF) - Rat deoxyribonuclease I (Dnase1), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Dnase1 (NM_013097) Rat Tagged ORF Clone Lentiviral Particle
RR205654L4V

USD 960.00

12 Weeks

Lenti ORF particles, Dnase1 (GFP-tagged ORF) - Rat deoxyribonuclease I (Dnase1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DNase I (DNASE1) (1-252) Rabbit Polyclonal Antibody
AP23615PU-N

USD 440.00

2 Weeks

DNase I (DNASE1) (1-252) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 1 and 252 of DNase I.
DNASE1 Rabbit Polyclonal Antibody
AP21248PU-N

USD 550.00

2 Weeks

DNASE1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, ID, IF, IP, R, WB
Reactivities Bovine
Immunogen Deoxyribonuclease I isolated and purified from Bovine pancreas.
Freund’s complete adjuvant is used in the first step of the immunization procedure.
DNase I (DNASE1) (NM_005223) Human Untagged Clone
SC116856

USD 310.00

In Stock

DNASE1 (untagged)-Human deoxyribonuclease I (DNASE1)

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
DNase I (DNASE1) Rabbit Polyclonal Antibody
TA308546

USD 415.00

In Stock

Rabbit Polyclonal antibody to DNase I (deoxyribonuclease I)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 282 of DNase I (Uniprot ID#P24855)
Dnase1 (NM_010061) Mouse Untagged Clone
MC201502

USD 210.00

In Stock

Dnase1 (untagged) - Mouse deoxyribonuclease I (Dnase1), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
DNase I (DNASE1) (NM_005223) Human Untagged Clone
SC324542

USD 310.00

In Stock

DNASE1 (untagged)-Human deoxyribonuclease I (DNASE1)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
DNase I (DNASE1) (NM_005223) Human Recombinant Protein
TP761147

USD 215.00

In Stock

Purified recombinant protein of Human deoxyribonuclease I (DNASE1), full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug

Tag N-GST and C-His
Expression Host E. coli
DNase I (DNASE1) (NM_005223) Human Tagged ORF Clone
RC205927L2

USD 620.00

3 Weeks

Lenti ORF clone of Human deoxyribonuclease I (DNASE1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
DNase I (DNASE1) (NM_005223) Human Over-expression Lysate
LC401601

USD 121.00

In Stock

DNASE1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
DNase I (DNASE1) Rabbit Polyclonal Antibody
TA339005

USD 375.00

5 Days

Rabbit Polyclonal Anti-DNASE1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DNASE1 antibody: synthetic peptide directed towards the N terminal of human DNASE1. Synthetic peptide located within the following region: GKLLDNLNQDAPDTYHYVVSEPLGRNSYKERYLFVYRPDQVSAVDSYYYD
Human DNase I (DNASE1) activation kit by CRISPRa
GA101232

USD 1,290.00

2 Weeks

DNASE1 CRISPRa kit - CRISPR gene activation of human deoxyribonuclease 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Dnase1 activation kit by CRISPRa
GA201099

USD 1,290.00

2 Weeks

Dnase1 CRISPRa kit - CRISPR gene activation of mouse deoxyribonuclease I

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
DNase I (DNASE1) Human qPCR Template Standard (NM_005223)
HK202583

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene DNASE1

Application Plasmid of exact quantity for transcript copy number calculation
DNase I (DNASE1) Human qPCR Primer Pair (NM_005223)
HP208399

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene DNASE1

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
Dnase1 Mouse qPCR Template Standard (NM_010061)
MK201090

USD 330.00

5 Days

qPCR primer pairs and template standards against Mus musculus gene Dnase1

Application Plasmid of exact quantity for transcript copy number calculation
Dnase1 Mouse qPCR Primer Pair (NM_010061)
MP203583

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Dnase1

Dnase1 (NM_013097) Rat Untagged Clone
RN205654

USD 420.00

4 Weeks

Dnase1 (untagged ORF) - Rat deoxyribonuclease I (Dnase1), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
DNase I (DNASE1) (NM_005223) Human 3' UTR Clone
SC201430

USD 560.00

4 Weeks

3`UTR clone of deoxyribonuclease I (DNASE1) for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
DNASE1 Human siRNA Oligo Duplex (Locus ID 1773)
SR301234

USD 430.00

2 Weeks

DNASE1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Dnase1 Mouse siRNA Oligo Duplex (Locus ID 13419)
SR426248

USD 430.00

2 Weeks

Dnase1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).
SR426248 is the updated version of SR408168.
Dnase1 Rat siRNA Oligo Duplex (Locus ID 25633)
SR505368

USD 430.00

2 Weeks

Dnase1 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

DNase I (DNASE1) Rabbit Polyclonal Antibody
TA349900

USD 345.00

In Stock

Rabbit Polyclonal Anti-DNASE1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DNASE1
DNASE1 Rabbit Polyclonal Antibody
TA364759

USD 380.00

4 Weeks

DNASE1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DNASE1
DNase I (DNASE1) Rabbit Polyclonal Antibody
TA375544

USD 275.00

3 Weeks

DNASE1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-282 of human DNASE1 (NP_005214.2).
Modifications Unmodified
DNase I (DNASE1) ICC Control Block
TB405927

USD 1,070.00

4 Weeks

Transient overexpression of DNASE1 (NM_005223) in HEK293T cells paraffin embedded controls for ICC/IHC staining

DNASE1 Human shRNA Plasmid Kit (Locus ID 1773)
TL313413

USD 815.00

2 Weeks

DNASE1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
E. coli Selection Chloramphenicol
Mammalian Cell Selection Puromycin
DNase I (DNASE1) Human shRNA Lentiviral Particle (Locus ID 1773)
TL313413V

USD 1,395.00

5 Weeks

DNASE1 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti
Dnase1 Mouse shRNA Plasmid (Locus ID 13419)
TL500545

USD 815.00

2 Weeks

Dnase1 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti