Products

cDNA Clones (35)
Proteins (29)
Antibodies (4)
Jump to Filters
View as table Download
ELOC (NM_005648) Human Tagged ORF Clone
RC201950

USD 98.00

USD 390.00

In Stock

TCEB1 (Myc-DDK-tagged)-Human transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) (TCEB1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
TCEB1 (ELOC) (NM_005648) Human Tagged ORF Clone Lentiviral Particle
RC201950L1V

USD 820.00

3 Weeks

Lenti ORF particles, TCEB1 (Myc-DDK tagged) - Human transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) (TCEB1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
TCEB1 (ELOC) (NM_005648) Human Tagged ORF Clone Lentiviral Particle
RC201950L2V

USD 820.00

6 Weeks

Lenti ORF particles, TCEB1 (mGFP-tagged) - Human transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) (TCEB1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
ELOC (NM_005648) Human Tagged ORF Clone
RG201950

USD 460.00

In Stock

TCEB1 (GFP-tagged) - Human transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) (TCEB1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ELOC (NM_001204857) Human Tagged ORF Clone
RC231669

USD 420.00

In Stock

TCEB1 (Myc-DDK tagged) - Homo sapiens transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) (TCEB1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ELOC (NM_001204858) Human Tagged ORF Clone
RC231670

USD 420.00

In Stock

TCEB1 (Myc-DDK tagged) - Homo sapiens transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) (TCEB1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ELOC (NM_001204859) Human Tagged ORF Clone
RC231671

USD 420.00

In Stock

TCEB1 (Myc-DDK tagged) - Homo sapiens transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) (TCEB1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ELOC (NM_001204860) Human Tagged ORF Clone
RC231672

USD 420.00

In Stock

TCEB1 (Myc-DDK tagged) - Homo sapiens transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) (TCEB1), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ELOC (NM_001204861) Human Tagged ORF Clone
RC231673

USD 420.00

In Stock

TCEB1 (Myc-DDK tagged) - Homo sapiens transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) (TCEB1), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ELOC (NM_001204862) Human Tagged ORF Clone
RC231674

USD 420.00

In Stock

TCEB1 (Myc-DDK tagged) - Homo sapiens transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) (TCEB1), transcript variant 7

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
TCEB1 (ELOC) (NM_005648) Human Tagged ORF Clone
RC201950L3

USD 620.00

3 Weeks

Lenti ORF clone of Human transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) (TCEB1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TCEB1 (ELOC) (NM_005648) Human Tagged ORF Clone Lentiviral Particle
RC201950L3V

USD 820.00

6 Weeks

Lenti ORF particles, TCEB1 (Myc-DDK tagged) - Human transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) (TCEB1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TCEB1 (ELOC) (NM_005648) Human Tagged ORF Clone
RC201950L4

USD 620.00

3 Weeks

Lenti ORF clone of Human transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) (TCEB1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TCEB1 (ELOC) (NM_005648) Human Tagged ORF Clone Lentiviral Particle
RC201950L4V

USD 820.00

6 Weeks

Lenti ORF particles, TCEB1 (mGFP-tagged) - Human transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) (TCEB1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ELOC (NM_001204863) Human Tagged ORF Clone
RC231618

USD 420.00

3 Weeks

TCEB1 (Myc-DDK tagged) - Homo sapiens transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) (TCEB1), transcript variant 8

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ELOC (NM_001204864) Human Tagged ORF Clone
RC231619

USD 420.00

3 Weeks

TCEB1 (Myc-DDK tagged) - Homo sapiens transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) (TCEB1), transcript variant 9

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ELOC (NM_001204863) Human Tagged ORF Clone
RG231618

USD 460.00

3 Weeks

TCEB1 (GFP-tagged) - Homo sapiens transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) (TCEB1), transcript variant 8

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ELOC (NM_001204864) Human Tagged ORF Clone
RG231619

USD 460.00

3 Weeks

TCEB1 (GFP-tagged) - Homo sapiens transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) (TCEB1), transcript variant 9

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ELOC (NM_001204857) Human Tagged ORF Clone
RG231669

USD 460.00

3 Weeks

TCEB1 (GFP-tagged) - Homo sapiens transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) (TCEB1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ELOC (NM_001204858) Human Tagged ORF Clone
RG231670

USD 460.00

3 Weeks

TCEB1 (GFP-tagged) - Homo sapiens transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) (TCEB1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ELOC (NM_001204859) Human Tagged ORF Clone
RG231671

USD 460.00

3 Weeks

TCEB1 (GFP-tagged) - Homo sapiens transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) (TCEB1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ELOC (NM_001204860) Human Tagged ORF Clone
RG231672

USD 460.00

3 Weeks

TCEB1 (GFP-tagged) - Homo sapiens transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) (TCEB1), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ELOC (NM_001204861) Human Tagged ORF Clone
RG231673

USD 460.00

3 Weeks

TCEB1 (GFP-tagged) - Homo sapiens transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) (TCEB1), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ELOC (NM_001204862) Human Tagged ORF Clone
RG231674

USD 460.00

3 Weeks

TCEB1 (GFP-tagged) - Homo sapiens transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) (TCEB1), transcript variant 7

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ELOC Rabbit Polyclonal Antibody [Clone ID: Poly6131]
TA328011

USD 265.00

In Stock

Rabbit Polyclonal anti-Elongin C Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant full-length
ELOC (NM_005648) Human Untagged Clone
SC116611

USD 310.00

In Stock

TCEB1 (untagged)-Human transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) (TCEB1), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
TCEB1 (ELOC) (NM_005648) Human Tagged ORF Clone
RC201950L1

USD 620.00

In Stock

Lenti ORF clone of Human transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) (TCEB1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
TCEB1 (ELOC) (NM_005648) Human Tagged ORF Clone
RC201950L2

USD 620.00

3 Weeks

Lenti ORF clone of Human transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) (TCEB1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
ELOC Rabbit Polyclonal Antibody
TA330158

USD 310.00

5 Days

Rabbit Polyclonal Anti-TCEB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TCEB1 antibody: synthetic peptide directed towards the middle region of human TCEB1. Synthetic peptide located within the following region: AENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALE
ELOC Rabbit Polyclonal Antibody
TA330159

USD 375.00

5 Days

Rabbit Polyclonal Anti-TCEB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TCEB1 antibody: synthetic peptide directed towards the N terminal of human TCEB1. Synthetic peptide located within the following region: EHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRY
TCEB1 (1-112, His-tag) Human Protein
AR50188PU-N

USD 845.00

2 Weeks

TCEB1 (1-112, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
TCEB1 (1-112, His-tag) Human Protein
AR50188PU-S

USD 330.00

2 Weeks

TCEB1 (1-112, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
ELOC (NM_005648) Human Over-expression Lysate
LC401737

USD 121.00

2 Weeks

TCEB1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
ELOC (NM_005648) Human Over-expression Lysate
LY401737

USD 396.00

5 Days

Transient overexpression lysate of transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) (TCEB1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ELOC (NM_001204857) Human Untagged Clone
SC329771

USD 310.00

3 Weeks

TCEB1 (untagged) - Homo sapiens transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) (TCEB1), transcript variant 2

Vector pCMV6 series
Tag Tag Free
ELOC (NM_001204858) Human Untagged Clone
SC329772

USD 310.00

3 Weeks

TCEB1 (untagged) - Homo sapiens transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) (TCEB1), transcript variant 3

Vector pCMV6 series
Tag Tag Free
ELOC (NM_001204859) Human Untagged Clone
SC329773

USD 310.00

3 Weeks

TCEB1 (untagged) - Homo sapiens transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) (TCEB1), transcript variant 4

Vector pCMV6 series
Tag Tag Free
ELOC (NM_001204860) Human Untagged Clone
SC329774

USD 310.00

3 Weeks

TCEB1 (untagged) - Homo sapiens transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) (TCEB1), transcript variant 5

Vector pCMV6 series
Tag Tag Free
ELOC (NM_001204861) Human Untagged Clone
SC329775

USD 310.00

3 Weeks

TCEB1 (untagged) - Homo sapiens transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) (TCEB1), transcript variant 6

Vector pCMV6 series
Tag Tag Free
ELOC (NM_001204862) Human Untagged Clone
SC329776

USD 310.00

3 Weeks

TCEB1 (untagged) - Homo sapiens transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) (TCEB1), transcript variant 7

Vector pCMV6 series
Tag Tag Free
ELOC (NM_001204863) Human Untagged Clone
SC329777

USD 310.00

3 Weeks

TCEB1 (untagged) - Homo sapiens transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) (TCEB1), transcript variant 8

Vector pCMV6 series
Tag Tag Free
ELOC (NM_001204864) Human Untagged Clone
SC329778

USD 310.00

3 Weeks

TCEB1 (untagged) - Homo sapiens transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) (TCEB1), transcript variant 9

Vector pCMV6 series
Tag Tag Free
ELOC Rabbit Polyclonal Antibody
TA350487

USD 345.00

In Stock

Rabbit Polyclonal Anti-TCEB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
ELOC ICC Control Block
TB401950

USD 1,040.00

4 Weeks

Transient overexpression of ELOC (NM_005648) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ELOC ICC Control Block
TB431618

USD 1,070.00

4 Weeks

Transient overexpression of ELOC (NM_001204863) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ELOC ICC Control Block
TB431619

USD 1,070.00

4 Weeks

Transient overexpression of ELOC (NM_001204864) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ELOC ICC Control Block
TB431669

USD 1,070.00

4 Weeks

Transient overexpression of ELOC (NM_001204857) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ELOC ICC Control Block
TB431670

USD 1,070.00

4 Weeks

Transient overexpression of ELOC (NM_001204858) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ELOC ICC Control Block
TB431671

USD 1,070.00

4 Weeks

Transient overexpression of ELOC (NM_001204859) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ELOC ICC Control Block
TB431672

USD 1,070.00

4 Weeks

Transient overexpression of ELOC (NM_001204860) in HEK293T cells paraffin embedded controls for ICC/IHC staining