Germany
Japan
United Kingdom
China
USD 480.00
In Stock
ESRRB (Myc-DDK-tagged)-Human estrogen-related receptor beta (ESRRB)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 480.00
In Stock
ESRRB (Myc-DDK-tagged)-Human estrogen-related receptor beta (ESRRB)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
USD 880.00
3 Weeks
Lenti ORF particles, ESRRB (Myc-DDK tagged) - Human estrogen-related receptor beta (ESRRB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 880.00
6 Weeks
Lenti ORF particles, ESRRB (mGFP-tagged) - Human estrogen-related receptor beta (ESRRB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
USD 880.00
3 Weeks
Lenti ORF particles, ESRRB (Myc-DDK-tagged)-Human estrogen-related receptor beta (ESRRB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 880.00
6 Weeks
Lenti ORF particles, ESRRB (mGFP-tagged)-Human estrogen-related receptor beta (ESRRB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
USD 530.00
In Stock
ESRRB (GFP-tagged) - Human estrogen-related receptor beta (ESRRB)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 680.00
3 Weeks
Lenti ORF clone of Human estrogen-related receptor beta (ESRRB), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 880.00
5 Weeks
Lenti ORF particles, ESRRB (Myc-DDK tagged) - Human estrogen-related receptor beta (ESRRB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 680.00
3 Weeks
Lenti ORF clone of Human estrogen-related receptor beta (ESRRB), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 880.00
7 Weeks
Lenti ORF particles, ESRRB (mGFP-tagged) - Human estrogen-related receptor beta (ESRRB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 680.00
3 Weeks
Lenti-ORF clone of ESRRB (Myc-DDK-tagged)-Human estrogen-related receptor beta (ESRRB)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 880.00
5 Weeks
Lenti ORF particles, ESRRB (Myc-DDK-tagged)-Human estrogen-related receptor beta (ESRRB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 680.00
3 Weeks
Lenti-ORF clone of ESRRB (mGFP-tagged)-Human estrogen-related receptor beta (ESRRB)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 880.00
7 Weeks
Lenti ORF particles, ESRRB (mGFP-tagged)-Human estrogen-related receptor beta (ESRRB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 530.00
3 Weeks
ESRRB (GFP-tagged) - Human estrogen-related receptor beta (ESRRB)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 840.00
In Stock
Lenti ORF clone of Human estrogen-related receptor beta (ESRRB), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
USD 396.00
In Stock
Transient overexpression lysate of estrogen-related receptor beta (ESRRB)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
USD 850.00
In Stock
ESRRB (untagged)-Human estrogen-related receptor beta (ESRRB)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
USD 850.00
In Stock
ESRRB (untagged)-Human estrogen-related receptor beta (ESRRB)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
USD 187.00
In Stock
ESRRB HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
USD 605.00
In Stock
Transient overexpression lysate of estrogen-related receptor beta (ESRRB)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
USD 680.00
3 Weeks
Lenti ORF clone of Human estrogen-related receptor beta (ESRRB), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
USD 680.00
3 Weeks
Lenti-ORF clone of ESRRB (mGFP-tagged)-Human estrogen-related receptor beta (ESRRB)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
USD 121.00
In Stock
ESRRB HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
ESRRB / ERR-Beta Rabbit Polyclonal (Ligand-binding Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | ESRRB / ERR Beta antibody was raised against synthetic 15 amino acid peptide from ligand-binding domain of human ESRRB. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Hamster, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum (100%); Mouse, Rat, Elephant, Turkey, Chicken, Lizard (93%); Bat (87%); Stickleback, Medaka, Pufferfish, Zebrafish (80%). |
Rabbit Polyclonal anti-ESRRB antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ESRRB antibody: synthetic peptide directed towards the N terminal of human ESRRB. Synthetic peptide located within the following region: RHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGLALGTHANG |
Rabbit Polyclonal Anti-ESRRB Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ESRRB antibody: synthetic peptide directed towards the N terminal of human ESRRB. Synthetic peptide located within the following region: SSDASGGFGLALGTHANGLDSPPMFAGAGLGGTPCRKSYEDCASGIMEDS |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ESRRB mouse monoclonal antibody, clone OTI2D7 (formerly 2D7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ESRRB mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ESRRB mouse monoclonal antibody, clone OTI1E6 (formerly 1E6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ESRRB mouse monoclonal antibody, clone OTI7C7 (formerly 7C7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) ESRRB mouse monoclonal antibody,clone OTI12B7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ESRRB mouse monoclonal antibody, clone OTI12H2 (formerly 12H2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 2,055.00
3 Weeks
ESRRB MS Standard C13 and N15-labeled recombinant protein (NP_004443)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Rabbit Polyclonal Anti-ESRRB Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ESRRB |
USD 379.00
In Stock
ESRRB mouse monoclonal antibody, clone OTI2D7 (formerly 2D7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ESRRB mouse monoclonal antibody, clone OTI2D7 (formerly 2D7), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
Estrogen Related Receptor beta (ESRRB) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D7]
USD 420.00
4 Weeks
ESRRB mouse monoclonal antibody, clone OTI2D7 (formerly 2D7), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
USD 159.00
2 Days
ESRRB mouse monoclonal antibody, clone OTI2D7 (formerly 2D7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 379.00
In Stock
ESRRB mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ESRRB mouse monoclonal antibody, clone OTI2F11 (formerly 2F11), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
ESRRB mouse monoclonal antibody, clone OTI2F11 (formerly 2F11), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
USD 159.00
2 Days
ESRRB mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 379.00
In Stock
ESRRB mouse monoclonal antibody, clone OTI1E6 (formerly 1E6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ESRRB mouse monoclonal antibody, clone OTI1E6 (formerly 1E6), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
Estrogen Related Receptor beta (ESRRB) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E6]
USD 420.00
4 Weeks
ESRRB mouse monoclonal antibody, clone OTI1E6 (formerly 1E6), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
USD 159.00
2 Days
ESRRB mouse monoclonal antibody, clone OTI1E6 (formerly 1E6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- ESRRB
Families
- Druggable Genome