EYA1 (Myc-DDK-tagged)-Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
EYA1 (Myc-DDK-tagged)-Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
EYA1 (Myc-DDK-tagged)-Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
EYA1 (Myc-DDK-tagged)-Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
EYA1 (Myc-DDK-tagged)-Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, EYA1 (Myc-DDK tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, EYA1 (mGFP-tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, EYA1 (Myc-DDK tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, EYA1 (mGFP-tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, EYA1 (Myc-DDK tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, EYA1 (mGFP-tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, EYA1 (Myc-DDK tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, EYA1 (mGFP-tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
EYA1 (GFP-tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
EYA1 (GFP-tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 4, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, EYA1 (Myc-DDK tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 4, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, EYA1 (mGFP-tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, EYA1 (Myc-DDK tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, EYA1 (mGFP-tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, EYA1 (Myc-DDK tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, EYA1 (mGFP-tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, EYA1 (Myc-DDK tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, EYA1 (mGFP-tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
EYA1 (myc-DDK-tagged) - Human EYA transcriptional coactivator and phosphatase 1 (EYA1), transcript variant 6
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
EYA1 (myc-DDK-tagged) - Human EYA transcriptional coactivator and phosphatase 1 (EYA1), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
EYA1 (GFP-tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
EYA1 (GFP-tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 4, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
EYA1 (untagged)-Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 3
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-CYP2A7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP2A7 antibody: synthetic peptide directed towards the middle region of human CYP2A7. Synthetic peptide located within the following region: KVEHNQRTLDPNSPQDFIDSFLIHMQEEEKNPNTEFYLKNLMMSTLNLFI |
Transient overexpression lysate of eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 4, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
EYA1 (untagged)-Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
EYA1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Goat Anti-EYA1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-TDPTAEYSTIHSP, from the internal region of the protein sequence according to NP_742057.1; NP_000494.2; NP_742056.1. |
EYA1 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human EYA1. |