Germany
Japan
United Kingdom
China
FAS (Myc-DDK-tagged)-Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
FAS (Myc-DDK-tagged)-Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
FAS (Myc-DDK-tagged)-Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 6
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
FAS (GFP-tagged) - Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Recombinant protein of human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
FAS (GFP-tagged) - Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
FAS (untagged)-Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF particles, FAS (Myc-DDK tagged) - Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, FAS (mGFP-tagged) - Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
FAS (GFP-tagged) - Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
FAS (GFP-tagged) - Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 6
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, FAS (Myc-DDK tagged) - Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, FAS (mGFP-tagged) - Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
FAS (Myc-DDK-tagged)-Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of FAS (Myc-DDK-tagged)-Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 3
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, FAS (Myc-DDK-tagged)-Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of FAS (mGFP-tagged)-Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 3
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, FAS (mGFP-tagged)-Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 6, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, FAS (Myc-DDK tagged) - Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 6, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 6, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, FAS (mGFP-tagged) - Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 6, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of FAS (Myc-DDK-tagged)-Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, FAS (Myc-DDK-tagged)-Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of FAS (mGFP-tagged)-Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, FAS (mGFP-tagged)-Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Purified recombinant protein of Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1.
| Tag | Tag Free |
| Expression Host | E. coli |
FAS Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FAS |
Transient overexpression lysate of Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 6
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Mouse Anti-Human CD95 (APO-1/Fas) Purified
| Applications | FC |
| Reactivities | Human |
FAS HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
FAS HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
FAS HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Purified recombinant protein of Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 6, full length, with N-terminal GST and C-terminal His tag,, expressed in E. coli, 50ug
| Tag | N-GST and C-His |
| Expression Host | E. coli |
CD95 (FAS) (Center) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | conjugated synthetic peptide selected from the Center region of human FAS |
CD95 (FAS) (323-327) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Peptide sequence around aa.323~327 derived from human Fas . |
CD95 (FAS) (323-327) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Peptide sequence around aa.323~327 derived from human Fas . |
Goat Anti-FAS / CD95 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KTCRKHRKENQGSH, from the internal region of the protein sequence according to NP_000034.1; NP_690610.1; NP_690611.1. |
Rabbit Polyclonal Anti-FAIM2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAIM2 antibody is: synthetic peptide directed towards the N-terminal region of Human FAIM2. Synthetic peptide located within the following region: QVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVD |
Mouse Monoclonal FAS (C-terminus) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti CD95 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Purified recombinant protein of Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1
| Tag | C-His |
| Expression Host | HEK293 |
Active filters
Target Symbol
- FAS
Families
- Druggable Genome
Filter by
Species
Reactivities
Antibody Hosts
Clonalities
Conjugates
Expression Hosts
Lentivirus
Tags
Vectors
Mutants
QC Levels
Mammalian Cell Selection
Pathways
- Allograft rejection (74)
- Alzheimer's disease (74)
- Apoptosis (74)
- Autoimmune thyroid disease (74)
- Cytokine-cytokine receptor interaction (74)
- Graft-versus-host disease (74)
- MAPK signaling pathway (74)
- Natural killer cell mediated cytotoxicity (74)
- Pathways in cancer (74)
- Type I diabetes mellitus (74)
- p53 signaling pathway (74)