Products

cDNA Clones (12)
Proteins (7)
Antibodies (2)
Jump to Filters
View as table Download
glucose 6 phosphatase, catalytic subunit (G6PC) Rabbit Polyclonal Antibody
TA334652

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-G6PC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM
glucose 6 phosphatase, catalytic subunit (G6PC) (NM_000151) Human Tagged ORF Clone Lentiviral Particle
RC215623L3V

USD 820.00

5 Weeks

Lenti ORF particles, G6PC (Myc-DDK tagged) - Human glucose-6-phosphatase, catalytic subunit (G6PC), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
glucose 6 phosphatase, catalytic subunit (G6PC) (NM_000151) Human Tagged ORF Clone Lentiviral Particle
RC215623L4V

USD 820.00

3 Weeks

Lenti ORF particles, G6PC (mGFP-tagged) - Human glucose-6-phosphatase, catalytic subunit (G6PC), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
glucose 6 phosphatase, catalytic subunit (G6PC) (NM_000151) Human Over-expression Lysate
LY424901

USD 396.00

2 Weeks

Transient overexpression lysate of glucose-6-phosphatase, catalytic subunit (G6PC)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

glucose 6 phosphatase, catalytic subunit (G6PC) Rabbit Polyclonal Antibody
TA334651

USD 375.00

5 Days

Rabbit Polyclonal Anti-G6pc Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-G6pc antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGI
glucose 6 phosphatase, catalytic subunit (G6PC) ICC Control Block
TB415623

USD 1,070.00

4 Weeks

Transient overexpression of G6PC (NM_000151) in HEK293T cells paraffin embedded controls for ICC/IHC staining

glucose 6 phosphatase, catalytic subunit (G6PC) ICC Control Block
TB431973

USD 1,070.00

4 Weeks

Transient overexpression of G6PC (NM_001270397) in HEK293T cells paraffin embedded controls for ICC/IHC staining

glucose 6 phosphatase, catalytic subunit (G6PC) Cytosection
TS415623

USD 225.00

4 Weeks

Transient overexpression of G6PC (NM_000151) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

glucose 6 phosphatase, catalytic subunit (G6PC) Cytosection
TS415623P5

USD 889.00

4 Weeks

Transient overexpression of G6PC (NM_000151) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

glucose 6 phosphatase, catalytic subunit (G6PC) ICC Control Sections
TS431973P5

USD 889.00

4 Weeks

Transient overexpression of G6PC (NM_001270397) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack