GRK1 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase 1 (GRK1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GRK1 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase 1 (GRK1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, GRK1 (Myc-DDK tagged) - Human G protein-coupled receptor kinase 1 (GRK1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, GRK1 (mGFP-tagged) - Human G protein-coupled receptor kinase 1 (GRK1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
GRK1 (GFP-tagged) - Human G protein-coupled receptor kinase 1 (GRK1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human G protein-coupled receptor kinase 1 (GRK1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GRK1 (Myc-DDK tagged) - Human G protein-coupled receptor kinase 1 (GRK1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human G protein-coupled receptor kinase 1 (GRK1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GRK1 (mGFP-tagged) - Human G protein-coupled receptor kinase 1 (GRK1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
GRK1 Mutant (P290L), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA
Mutation | P290L |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GRK1 Mutant (T298M), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA
Mutation | T298M |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GRK1 Mutant (N330S), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA
Mutation | N330S |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GRK1 Mutant (V380D), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA
Mutation | V380D |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GRK1 Mutant (P391H), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA
Mutation | P391H |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GRK1 Mutant (R438H), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA
Mutation | R438H |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GRK1 Mutant (W460R), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA
Mutation | W460R |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GRK1 Mutant (C514S), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA
Mutation | C514S |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GRK1 Mutant (M522T), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA
Mutation | M522T |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GRK1 Mutant (S536L), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA
Mutation | S536L |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human G protein-coupled receptor kinase 1 (GRK1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
GRK1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human GRK1 |
GRK1 (untagged)-Human G protein-coupled receptor kinase 1 (GRK1)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal GRK1 (Ab-21) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human GRK1 around the phosphorylation site of serine 21 (R-G-SP-F-D) |
Lenti ORF clone of Human G protein-coupled receptor kinase 1 (GRK1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
GRK1 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
GRK1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of G protein-coupled receptor kinase 1 (GRK1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-GRK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GRK1 antibody: synthetic peptide directed towards the middle region of human GRK1. Synthetic peptide located within the following region: NKELKHRIISEPVKYPDKFSQASKDFCEALLEKDPEKRLGFRDETCDKLR |
Carrier-free (BSA/glycerol-free) GRK1 mouse monoclonal antibody,clone OTI1E11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GRK1 mouse monoclonal antibody,clone OTI4G8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GRK1 MS Standard C13 and N15-labeled recombinant protein (NP_002920)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Anti-GRK1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 21-35 amino acids of Human G protein-coupled receptor kinase 1 |
GRK1 mouse monoclonal antibody,clone OTI1E11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
GRK1 mouse monoclonal antibody,clone OTI1E11, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
GRK1 mouse monoclonal antibody,clone OTI1E11, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
GRK1 mouse monoclonal antibody,clone OTI1E11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GRK1 mouse monoclonal antibody,clone OTI4G8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GRK1 mouse monoclonal antibody,clone OTI4G8, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
GRK1 mouse monoclonal antibody,clone OTI4G8, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
GRK1 mouse monoclonal antibody,clone OTI4G8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of GRK1 (NM_002929) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GRK1 (NM_002929) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GRK1 (NM_002929) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack