GRK1 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase 1 (GRK1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GRK1 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase 1 (GRK1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, GRK1 (Myc-DDK tagged) - Human G protein-coupled receptor kinase 1 (GRK1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, GRK1 (mGFP-tagged) - Human G protein-coupled receptor kinase 1 (GRK1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
GRK1 (GFP-tagged) - Human G protein-coupled receptor kinase 1 (GRK1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Grk1 (Myc-DDK-tagged) - Mouse G protein-coupled receptor kinase 1 (Grk1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GRK1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Grk1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Grk1 (GFP-tagged) - Mouse G protein-coupled receptor kinase 1 (Grk1), (10ug)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Grk1 (Myc-DDK-tagged) - Mouse G protein-coupled receptor kinase 1 (Grk1)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Grk1 (Myc-DDK-tagged) - Mouse G protein-coupled receptor kinase 1 (Grk1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Grk1 (mGFP-tagged) - Mouse G protein-coupled receptor kinase 1 (Grk1)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Grk1 (GFP-tagged) - Mouse G protein-coupled receptor kinase 1 (Grk1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human G protein-coupled receptor kinase 1 (GRK1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GRK1 (Myc-DDK tagged) - Human G protein-coupled receptor kinase 1 (GRK1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human G protein-coupled receptor kinase 1 (GRK1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GRK1 (mGFP-tagged) - Human G protein-coupled receptor kinase 1 (GRK1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
GRK1 Mutant (P290L), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA
Mutation | P290L |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GRK1 Mutant (T298M), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA
Mutation | T298M |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GRK1 Mutant (N330S), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA
Mutation | N330S |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GRK1 Mutant (V380D), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA
Mutation | V380D |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GRK1 Mutant (P391H), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA
Mutation | P391H |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GRK1 Mutant (R438H), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA
Mutation | R438H |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GRK1 Mutant (W460R), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA
Mutation | W460R |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GRK1 Mutant (C514S), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA
Mutation | C514S |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GRK1 Mutant (M522T), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA
Mutation | M522T |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GRK1 Mutant (S536L), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA
Mutation | S536L |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Grk1 (Myc-DDK-tagged ORF) - Rat G protein-coupled receptor kinase 1 (Grk1), (10 ug)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Grk1 (Myc-DDK-tagged ORF) - Rat G protein-coupled receptor kinase 1 (Grk1), (10 ug)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Grk1 (Myc-DDK-tagged ORF) - Rat G protein-coupled receptor kinase 1 (Grk1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Grk1 (mGFP-tagged ORF) - Rat G protein-coupled receptor kinase 1 (Grk1), (10 ug)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Grk1 (GFP-tagged ORF) - Rat G protein-coupled receptor kinase 1 (Grk1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human G protein-coupled receptor kinase 1 (GRK1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
GRK1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human GRK1 |
GRK1 (untagged)-Human G protein-coupled receptor kinase 1 (GRK1)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal GRK1 (Ab-21) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human GRK1 around the phosphorylation site of serine 21 (R-G-SP-F-D) |
Lenti ORF clone of Human G protein-coupled receptor kinase 1 (GRK1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
GRK1 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
GRK1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of G protein-coupled receptor kinase 1 (GRK1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GRK1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
GRK1 - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector
Format | Retroviral plasmids |
Vector | pRFP-C-RS |
GRK1 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
Format | Retroviral plasmids |
Vector | pRS |
Rabbit Polyclonal Anti-GRK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GRK1 antibody: synthetic peptide directed towards the middle region of human GRK1. Synthetic peptide located within the following region: NKELKHRIISEPVKYPDKFSQASKDFCEALLEKDPEKRLGFRDETCDKLR |
Carrier-free (BSA/glycerol-free) GRK1 mouse monoclonal antibody,clone OTI1E11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GRK1 mouse monoclonal antibody,clone OTI4G8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GRK1 CRISPRa kit - CRISPR gene activation of human G protein-coupled receptor kinase 1
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Grk1 CRISPRa kit - CRISPR gene activation of mouse G protein-coupled receptor kinase 1
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene GRK1
Grk1 (untagged) - Mouse G protein-coupled receptor kinase 1 (Grk1), (10ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Grk1