Products

View as table Download

GRK1 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase 1 (GRK1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, GRK1 (Myc-DDK tagged) - Human G protein-coupled receptor kinase 1 (GRK1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, GRK1 (mGFP-tagged) - Human G protein-coupled receptor kinase 1 (GRK1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

GRK1 (GFP-tagged) - Human G protein-coupled receptor kinase 1 (GRK1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Grk1 (Myc-DDK-tagged) - Mouse G protein-coupled receptor kinase 1 (Grk1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

GRK1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN414569 is the updated version of KN214569.

Grk1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN507340 is the updated version of KN307340.

Grk1 (GFP-tagged) - Mouse G protein-coupled receptor kinase 1 (Grk1), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Grk1 (Myc-DDK-tagged) - Mouse G protein-coupled receptor kinase 1 (Grk1)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Grk1 (Myc-DDK-tagged) - Mouse G protein-coupled receptor kinase 1 (Grk1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Grk1 (mGFP-tagged) - Mouse G protein-coupled receptor kinase 1 (Grk1)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Grk1 (GFP-tagged) - Mouse G protein-coupled receptor kinase 1 (Grk1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human G protein-coupled receptor kinase 1 (GRK1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GRK1 (Myc-DDK tagged) - Human G protein-coupled receptor kinase 1 (GRK1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human G protein-coupled receptor kinase 1 (GRK1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GRK1 (mGFP-tagged) - Human G protein-coupled receptor kinase 1 (GRK1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

GRK1 Mutant (P290L), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA

Mutation P290L
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

GRK1 Mutant (T298M), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA

Mutation T298M
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

GRK1 Mutant (N330S), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA

Mutation N330S
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

GRK1 Mutant (V380D), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA

Mutation V380D
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

GRK1 Mutant (P391H), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA

Mutation P391H
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

GRK1 Mutant (R438H), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA

Mutation R438H
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

GRK1 Mutant (W460R), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA

Mutation W460R
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

GRK1 Mutant (C514S), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA

Mutation C514S
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

GRK1 Mutant (M522T), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA

Mutation M522T
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

GRK1 Mutant (S536L), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 1 (GRK1) as transfection-ready DNA

Mutation S536L
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Grk1 (Myc-DDK-tagged ORF) - Rat G protein-coupled receptor kinase 1 (Grk1), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Grk1 (Myc-DDK-tagged ORF) - Rat G protein-coupled receptor kinase 1 (Grk1), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Grk1 (Myc-DDK-tagged ORF) - Rat G protein-coupled receptor kinase 1 (Grk1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Grk1 (mGFP-tagged ORF) - Rat G protein-coupled receptor kinase 1 (Grk1), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Grk1 (GFP-tagged ORF) - Rat G protein-coupled receptor kinase 1 (Grk1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human G protein-coupled receptor kinase 1 (GRK1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

GRK1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human GRK1

GRK1 (untagged)-Human G protein-coupled receptor kinase 1 (GRK1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit polyclonal GRK1 (Ab-21) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human GRK1 around the phosphorylation site of serine 21 (R-G-SP-F-D)

Lenti ORF clone of Human G protein-coupled receptor kinase 1 (GRK1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

GRK1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

GRK1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of G protein-coupled receptor kinase 1 (GRK1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

GRK1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

GRK1 - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector

Format Retroviral plasmids
Vector pRFP-C-RS

GRK1 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS

Rabbit Polyclonal Anti-GRK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GRK1 antibody: synthetic peptide directed towards the middle region of human GRK1. Synthetic peptide located within the following region: NKELKHRIISEPVKYPDKFSQASKDFCEALLEKDPEKRLGFRDETCDKLR

Carrier-free (BSA/glycerol-free) GRK1 mouse monoclonal antibody,clone OTI1E11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GRK1 mouse monoclonal antibody,clone OTI4G8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GRK1 CRISPRa kit - CRISPR gene activation of human G protein-coupled receptor kinase 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

Grk1 CRISPRa kit - CRISPR gene activation of mouse G protein-coupled receptor kinase 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

qSTAR qPCR primer pairs against Homo sapiens gene GRK1

Grk1 (untagged) - Mouse G protein-coupled receptor kinase 1 (Grk1), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

qSTAR qPCR primer pairs against Mus musculus gene Grk1