Products

cDNA Clones (31)
Proteins (15)
Antibodies (3)
Jump to Filters
View as table Download
GRK6 (NM_001004106) Human Tagged ORF Clone
RC202464

USD 420.00

In Stock

GRK6 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GRK6 (NM_002082) Human Tagged ORF Clone
RC218924

USD 480.00

In Stock

GRK6 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GRK6 (NM_001004106) Human Recombinant Protein
TP302464

USD 867.00

In Stock

Recombinant protein of human G protein-coupled receptor kinase 6 (GRK6), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
GRK6 (NM_001004106) Human Tagged ORF Clone Lentiviral Particle
RC202464L1V

USD 820.00

3 Weeks

Lenti ORF particles, GRK6 (Myc-DDK tagged) - Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
GRK6 (NM_001004106) Human Tagged ORF Clone Lentiviral Particle
RC202464L2V

USD 820.00

6 Weeks

Lenti ORF particles, GRK6 (mGFP-tagged) - Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
GRK6 (NM_002082) Human Tagged ORF Clone Lentiviral Particle
RC218924L1V

USD 880.00

3 Weeks

Lenti ORF particles, GRK6 (Myc-DDK tagged) - Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
GRK6 (NM_002082) Human Tagged ORF Clone Lentiviral Particle
RC218924L2V

USD 880.00

6 Weeks

Lenti ORF particles, GRK6 (mGFP-tagged) - Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
GRK6 (NM_001004106) Human Tagged ORF Clone
RG202464

USD 460.00

In Stock

GRK6 (GFP-tagged) - Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GRK6 (NM_001004105) Human Tagged ORF Clone
RC224049

USD 520.00

In Stock

GRK6 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GRK6 (NM_002082) Human Tagged ORF Clone
RG218924

USD 530.00

In Stock

GRK6 (GFP-tagged) - Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GRK6 (NM_001004106) Human Tagged ORF Clone
RC202464L3

USD 620.00

3 Weeks

Lenti ORF clone of Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GRK6 (NM_001004106) Human Tagged ORF Clone Lentiviral Particle
RC202464L3V

USD 820.00

5 Weeks

Lenti ORF particles, GRK6 (Myc-DDK tagged) - Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GRK6 (NM_001004106) Human Tagged ORF Clone
RC202464L4

USD 620.00

3 Weeks

Lenti ORF clone of Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GRK6 (NM_001004106) Human Tagged ORF Clone Lentiviral Particle
RC202464L4V

USD 820.00

7 Weeks

Lenti ORF particles, GRK6 (mGFP-tagged) - Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GRK6 (NM_002082) Human Tagged ORF Clone
RC218924L3

USD 680.00

3 Weeks

Lenti ORF clone of Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GRK6 (NM_002082) Human Tagged ORF Clone Lentiviral Particle
RC218924L3V

USD 880.00

7 Weeks

Lenti ORF particles, GRK6 (Myc-DDK tagged) - Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GRK6 (NM_002082) Human Tagged ORF Clone
RC218924L4

USD 680.00

3 Weeks

Lenti ORF clone of Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GRK6 (NM_002082) Human Tagged ORF Clone Lentiviral Particle
RC218924L4V

USD 880.00

7 Weeks

Lenti ORF particles, GRK6 (mGFP-tagged) - Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GRK6 (NM_001004105) Human Tagged ORF Clone
RC224049L3

USD 720.00

3 Weeks

Lenti-ORF clone of GRK6 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GRK6 (NM_001004105) Human Tagged ORF Clone Lentiviral Particle
RC224049L3V

USD 920.00

6 Weeks

Lenti ORF particles, GRK6 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GRK6 (NM_001004105) Human Tagged ORF Clone
RC224049L4

USD 720.00

3 Weeks

Lenti-ORF clone of GRK6 (mGFP-tagged)-Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GRK6 (NM_001004105) Human Tagged ORF Clone Lentiviral Particle
RC224049L4V

USD 920.00

6 Weeks

Lenti ORF particles, GRK6 (mGFP-tagged)-Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GRK6 (NM_001004105) Human Tagged ORF Clone
RG224049

USD 570.00

3 Weeks

GRK6 (GFP-tagged) - Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GRK6 (NM_002082) Human Untagged Clone
SC108487

USD 760.00

In Stock

GRK6 (untagged)-Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
GRK6 (NM_001004106) Human Tagged Lenti ORF Clone
RC202464L1

USD 768.00

In Stock

Lenti ORF clone of Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
GRK6 (NM_002082) Human Tagged ORF Clone
RC218924L1

USD 840.00

In Stock

Lenti ORF clone of Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
GRK6 (NM_001004106) Human Untagged Clone
SC320538

USD 760.00

In Stock

GRK6 (untagged)-Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
GRK6 Rabbit Polyclonal Antibody
TA313284

USD 345.00

In Stock

Rabbit polyclonal anti-GRK6 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human GRK6.
GRK6 (NM_001004106) Human Tagged ORF Clone
RC202464L2

USD 620.00

3 Weeks

Lenti ORF clone of Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
GRK6 (NM_002082) Human Tagged ORF Clone
RC218924L2

USD 680.00

3 Weeks

Lenti ORF clone of Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
GRK6 (NM_002082) Human Untagged Clone
SC323679

USD 760.00

In Stock

GRK6 (untagged)-Kinase deficient mutant (K215M) of Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
GRK6 Rabbit Polyclonal Antibody
TA326701

USD 430.00

5 Days

Rabbit Polyclonal GRK6 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GRK6 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human GRK6.
GRK6 (NM_002082) Human Over-expression Lysate
LC419550

USD 187.00

In Stock

GRK6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GRK6 (NM_001004106) Human Over-expression Lysate
LC424064

USD 121.00

In Stock

GRK6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GRK6 (NM_001004106) Human Untagged Clone
SC300602

USD 760.00

2 Weeks

GRK6 (untagged)-Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
GRK6 Rabbit Polyclonal Antibody
TA343155

USD 375.00

5 Days

Rabbit Polyclonal Anti-GRK6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GRK6 antibody is: synthetic peptide directed towards the C-terminal region of Human GRK6. Synthetic peptide located within the following region: LYEMIAGQSPFQQRKKKIKREEVERLVKEVPEEYSERFSPQARSLCSQLL
GRK6 (NM_001004106) Human Mass Spec Standard
PH302464

USD 2,055.00

3 Weeks

GRK6 MS Standard C13 and N15-labeled recombinant protein (NP_001004106)

Tag C-Myc/DDK
Expression Host HEK293
GRK6 (NM_001004105) Human Untagged Clone
SC300601

USD 950.00

4 Weeks

GRK6 (untagged)-Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 3

Vector pCMV6 series
Tag Tag Free
GRK6 ICC Control Block
TB402464

USD 1,070.00

4 Weeks

Transient overexpression of GRK6 (NM_001004106) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GRK6 ICC Control Block
TB418924

USD 1,130.00

4 Weeks

Transient overexpression of GRK6 (NM_002082) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GRK6 ICC Control Block
TB424049

USD 1,170.00

4 Weeks

Transient overexpression of GRK6 (NM_001004105) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GRK6 Cytosection
TS402464

USD 225.00

4 Weeks

Transient overexpression of GRK6 (NM_001004106) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GRK6 Cytosection
TS402464P5

USD 889.00

4 Weeks

Transient overexpression of GRK6 (NM_001004106) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

GRK6 Cytosection
TS418924

USD 225.00

4 Weeks

Transient overexpression of GRK6 (NM_002082) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GRK6 Cytosection
TS418924P5

USD 889.00

4 Weeks

Transient overexpression of GRK6 (NM_002082) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

GRK6 Cytosection
TS424049

USD 225.00

4 Weeks

Transient overexpression of GRK6 (NM_001004105) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GRK6 Cytosection
TS424049P5

USD 889.00

4 Weeks

Transient overexpression of GRK6 (NM_001004105) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack