Products

cDNA Clones (49)
Proteins (23)
Antibodies (7)
Jump to Filters
View as table Download
KCNMA1 (NM_002247) Human Tagged ORF Clone
RG215099

USD 1,540.00

In Stock

KCNMA1 (GFP-tagged) - Human potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
KCNMA1 (NM_002247) Human Tagged ORF Clone
RC215099

USD 1,240.00

In Stock

KCNMA1 (Myc-DDK-tagged)-Human potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
KCNMA1 (NM_002247) Human Tagged ORF Clone Lentiviral Particle
RC215099L1V

USD 1,640.00

6 Weeks

Lenti ORF particles, KCNMA1 (Myc-DDK-tagged)-Human potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
KCNMA1 (NM_002247) Human Tagged ORF Clone Lentiviral Particle
RC215099L2V

USD 1,640.00

6 Weeks

Lenti ORF particles, KCNMA1 (mGFP-tagged)-Human potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
KCNMA1 (NM_001014797) Human Tagged ORF Clone
RC223473

USD 1,240.00

In Stock

KCNMA1 (Myc-DDK-tagged)-Human potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
KCNMA1 (NM_001161352) Human Tagged ORF Clone
RC228657

USD 1,300.00

In Stock

KCNMA1 (Myc-DDK-tagged)-Human potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
KCNMA1 (NM_001014797) Human Tagged ORF Clone
RG223473

USD 1,360.00

2 Weeks

KCNMA1 (GFP-tagged) - Human potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
KCNMA1 (NM_002247) Human Tagged ORF Clone
RC215099L3

USD 1,440.00

3 Weeks

Lenti-ORF clone of KCNMA1 (Myc-DDK-tagged)-Human potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMA1 (NM_002247) Human Tagged ORF Clone Lentiviral Particle
RC215099L3V

USD 1,640.00

6 Weeks

Lenti ORF particles, KCNMA1 (Myc-DDK-tagged)-Human potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMA1 (NM_002247) Human Tagged ORF Clone Lentiviral Particle
RC215099L4V

USD 1,640.00

3 Weeks

Lenti ORF particles, KCNMA1 (mGFP-tagged)-Human potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMA1 (NM_001014797) Human Tagged ORF Clone
RC223473L3

USD 1,440.00

3 Weeks

Lenti-ORF clone of KCNMA1 (Myc-DDK-tagged)-Human potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMA1 (NM_001014797) Human Tagged ORF Clone Lentiviral Particle
RC223473L3V

USD 1,640.00

6 Weeks

Lenti ORF particles, KCNMA1 (Myc-DDK-tagged)-Human potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMA1 (NM_001014797) Human Tagged ORF Clone Lentiviral Particle
RC223473L4V

USD 1,640.00

3 Weeks

Lenti ORF particles, KCNMA1 (mGFP-tagged)-Human potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMA1 (NM_001161353) Human Tagged ORF Clone
RC228653

USD 1,280.00

6 Weeks

KCNMA1 (Myc-DDK-tagged)-Human potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
KCNMA1 (NM_001161353) Human Tagged ORF Clone
RC228653L3

USD 1,480.00

6 Weeks

Lenti-ORF clone of KCNMA1 (Myc-DDK-tagged)-Human potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMA1 (NM_001161353) Human Tagged ORF Clone Lentiviral Particle
RC228653L3V

USD 1,680.00

9 Weeks

Lenti ORF particles, KCNMA1 (Myc-DDK-tagged)-Human potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMA1 (NM_001161353) Human Tagged ORF Clone
RC228653L4

USD 1,480.00

6 Weeks

Lenti-ORF clone of KCNMA1 (mGFP-tagged)-Human potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMA1 (NM_001161353) Human Tagged ORF Clone Lentiviral Particle
RC228653L4V

USD 1,680.00

9 Weeks

Lenti ORF particles, KCNMA1 (mGFP-tagged)-Human potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMA1 (NM_001161352) Human Tagged ORF Clone
RC228657L3

USD 1,500.00

3 Weeks

Lenti ORF clone of Human potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMA1 (NM_001161352) Human Tagged ORF Clone Lentiviral Particle
RC228657L3V

USD 1,700.00

6 Weeks

Lenti ORF particles, KCNMA1 (Myc-DDK tagged) - Human potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMA1 (NM_001161352) Human Tagged ORF Clone
RC228657L4

USD 1,500.00

3 Weeks

Lenti ORF clone of Human potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMA1 (NM_001161352) Human Tagged ORF Clone Lentiviral Particle
RC228657L4V

USD 1,700.00

6 Weeks

Lenti ORF particles, KCNMA1 (mGFP-tagged) - Human potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMA1 (NM_001271522) Human Tagged ORF Clone
RC233349

USD 420.00

3 Weeks

KCNMA1 (Myc-DDK tagged) - Homo sapiens potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 9

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
KCNMA1 (NM_001271520) Human Tagged ORF Clone
RC233460

USD 420.00

3 Weeks

KCNMA1 (Myc-DDK tagged) - Homo sapiens potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 7

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
KCNMA1 (NM_001271518) Human Tagged ORF Clone
RC235178

USD 1,180.00

8 Weeks

KCNMA1 (Myc-DDK tagged) - Homo sapiens potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
KCNMA1 (NM_001271519) Human Tagged ORF Clone
RC235216

USD 1,270.00

8 Weeks

KCNMA1 (Myc-DDK tagged) - Homo sapiens potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
KCNMA1 (NM_001271521) Human Tagged ORF Clone
RC235867

USD 420.00

2 Weeks

KCNMA1 (myc-DDK-tagged) - Human potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 8

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
KCNMA1 (NM_001161353) Human Tagged ORF Clone
RG228653

USD 1,410.00

6 Weeks

KCNMA1 (GFP-tagged) - Human potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
KCNMA1 (NM_001161352) Human Tagged ORF Clone
RG228657

USD 1,430.00

3 Weeks

KCNMA1 (GFP-tagged) - Human potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
KCNMA1 (NM_001271522) Human Tagged ORF Clone
RG233349

USD 460.00

3 Weeks

KCNMA1 (GFP-tagged) - Homo sapiens potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 9

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
KCNMA1 (NM_001271520) Human Tagged ORF Clone
RG233460

USD 460.00

3 Weeks

KCNMA1 (GFP-tagged) - Homo sapiens potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 7

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
KCNMA1 (NM_001271518) Human Tagged ORF Clone
RG235178

USD 1,300.00

8 Weeks

KCNMA1 (GFP-tagged) - Homo sapiens potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
KCNMA1 (NM_001271519) Human Tagged ORF Clone
RG235216

USD 1,400.00

8 Weeks

KCNMA1 (GFP-tagged) - Homo sapiens potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
KCNMA1 (NM_002247) Human Untagged Clone
SC122078

USD 1,100.00

In Stock

KCNMA1 (untagged)-Human potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
SC122078 is the updated version of SC122141.
KCNMA1 (NM_001014797) Human Tagged ORF Clone
RC223473L4

USD 1,776.00

In Stock

Lenti-ORF clone of KCNMA1 (mGFP-tagged)-Human potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMA1 (NM_002247) Human Over-expression Lysate
LY400815

USD 605.00

5 Days

Transient overexpression lysate of potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
KCNMA1 (NM_002247) Human Untagged Clone
SC318535

USD 1,100.00

2 Weeks

KCNMA1 (untagged)-Human potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 2

Vector pCMV6 series
Tag Tag Free
KCNMA1 Rabbit Polyclonal Antibody
AP20653PU-N

USD 370.00

2 Weeks

KCNMA1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 750-800 of Human MaxiKα
KCNMA1 Mouse Monoclonal Antibody [Clone ID: S6-60]
TA309477

USD 410.00

In Stock

Mouse Monoclonal anti-slo1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat, Zebrafish
Conjugation Unconjugated
KCNMA1 (NM_002247) Human Tagged ORF Clone
RC215099L1

USD 1,440.00

3 Weeks

Lenti-ORF clone of KCNMA1 (Myc-DDK-tagged)-Human potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 2

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
KCNMA1 (NM_002247) Human Tagged ORF Clone
RC215099L2

USD 1,440.00

3 Weeks

Lenti-ORF clone of KCNMA1 (mGFP-tagged)-Human potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 2

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
KCNMA1 Rabbit Polyclonal Antibody
TA338525

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCNMA1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNMA1 antibody: synthetic peptide directed towards the c terminal region of human KCNMA1. Synthetic peptide located within the following region: CFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDHNAG
KCNMA1 (NM_002247) Human Over-expression Lysate
LC400815

USD 187.00

2 Weeks

KCNMA1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
KCNMA1 (NM_001014797) Human Untagged Clone
SC125444

USD 2,390.00

In Stock

KCNMA1 (untagged)-Human potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
KCNMA1 Rabbit Polyclonal Antibody
TA316944

USD 425.00

5 Days

KCNMA1 / BK Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Dog, Pig
Conjugation Unconjugated
Immunogen KCNMA1 / BK antibody was raised against synthetic 15 amino acid peptide from internal region of human KCNMA1. Percent identity with other species by BLAST analysis: Human, Monkey, Mouse, Rat, Hamster, Bovine, Dog, Rabbit, Pig, Turkey, Chicken, Xenopus, Seabass, Stickleback, Pufferfish, Zebrafish (100%).
KCNMA1 Rabbit Polyclonal Antibody
TA316945

USD 425.00

5 Days

KCNMA1 / BK Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Pig, Horse
Conjugation Unconjugated
Immunogen KCNMA1 / BK antibody was raised against synthetic 15 amino acid peptide from internal region of human KCNMA1. Percent identity with other species by BLAST analysis: Human, Monkey, Mouse, Rat, Hamster, Bovine, Horse, Rabbit, Pig, Turkey, Chicken, Xenopus, Seabass, Stickleback, Pufferfish, Zebrafish (100%).
KCNMA1 Rabbit Polyclonal Antibody
TA331455

USD 375.00

5 Days

Rabbit polyclonal Anti-KCNMA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNMA1 antibody: synthetic peptide directed towards the middle region of human KCNMA1. Synthetic peptide located within the following region: ESRSRKRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITD
KCNMA1 (NM_002247) Human Tagged ORF Clone
RC215099L4

USD 1,440.00

In Stock

Lenti-ORF clone of KCNMA1 (mGFP-tagged)-Human potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNMA1 (NM_001271521) Human Tagged ORF Clone
RG235867

USD 460.00

2 Weeks

KCNMA1 (GFP-tagged) - Human potassium large conductance calcium-activated channel, subfamily M, alpha member 1 (KCNMA1), transcript variant 8

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
KCNMA1 (BC024965) Human Untagged Clone
SC105081

USD 500.00

2 Weeks

(untagged)-Homo sapiens, clone IMAGE:4447157

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None