KCNQ1 (Myc-DDK-tagged)-Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
KCNQ1 (Myc-DDK-tagged)-Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
KCNQ1 (Myc-DDK-tagged)-Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
KCNQ1 (GFP-tagged) - Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, KCNQ1 (Myc-DDK tagged) - Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, KCNQ1 (mGFP-tagged) - Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, KCNQ1 (Myc-DDK tagged) - Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, KCNQ1 (mGFP-tagged) - Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
KCNQ1 (GFP-tagged) - Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
KCNQ1 (untagged)-Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, KCNQ1 (Myc-DDK tagged) - Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, KCNQ1 (mGFP-tagged) - Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, KCNQ1 (Myc-DDK tagged) - Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, KCNQ1 (mGFP-tagged) - Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Transient overexpression lysate of potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
KCNQ1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human KCNQ1 |
Rabbit Polyclonal Anti-KCNQ1 Antibody
Applications | IHC, WB |
Reactivities | Hamster, Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNQ1 antibody: synthetic peptide directed towards the N terminal of human KCNQ1. Synthetic peptide located within the following region: RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGI |
Lenti ORF clone of Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
KCNQ1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
KCNQ1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
KCNQ1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Mouse monoclonal KCNQ1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Purified recombinant protein of Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2, Ala257-End, with N-terminal His tag, expressed in E.coli, 50ug
Tag | N-His |
Expression Host | E. coli |
KCNQ1 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 11-42 amino acids from the N-terminal region of human KCNQ1 |
Goat Anti-KCNQ1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EQLTVPRRGPDEGS, from the C-Terminus of the protein sequence according to NP_000209.2; NP_861463.1. |
Rabbit Polyclonal Anti-KV7.1 (KCNQ1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)TYEQLTVPRRGPDEGS, corresponding to amino acid residues 661-676 of human Kv7.1. Intracellular, C-terminus. |
Rabbit Polyclonal Anti-KCNQ1 Antibody
Applications | WB |
Reactivities | Hamster, Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNQ1 antibody: synthetic peptide directed towards the N terminal of human KCNQ1. Synthetic peptide located within the following region: IVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGS |
Transient overexpression lysate of potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
KCNQ1 (untagged)-Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-KCNQ1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human KCNQ1 |
Transient overexpression of KCNQ1 (NM_181798) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of KCNQ1 (NM_000218) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of KCNQ1 (NM_181798) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of KCNQ1 (NM_181798) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of KCNQ1 (NM_000218) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of KCNQ1 (NM_000218) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack