Germany
Japan
United Kingdom
China
KCNQ1 (Myc-DDK-tagged)-Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
KCNQ1 (Myc-DDK-tagged)-Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
KCNQ1 (GFP-tagged) - Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Kcnq1 (Myc-DDK-tagged) - Mouse potassium voltage-gated channel, subfamily Q, member 1 (Kcnq1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, KCNQ1 (Myc-DDK tagged) - Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, KCNQ1 (mGFP-tagged) - Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, KCNQ1 (Myc-DDK tagged) - Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, KCNQ1 (mGFP-tagged) - Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
KCNQ1 (GFP-tagged) - Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
KCNQ1 (untagged)-Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
KCNQ1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN412479 is the updated version of KN212479.
Kcnq1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN508686 is the updated version of KN308686.
Kcnq1 (GFP-tagged) - Mouse potassium voltage-gated channel, subfamily Q, member 1 (cDNA clone MGC:54702 IMAGE:6314642)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Kcnq1 (Myc-DDK-tagged) - Mouse potassium voltage-gated channel, subfamily Q, member 1 (Kcnq1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Kcnq1 (Myc-DDK-tagged) - Mouse potassium voltage-gated channel, subfamily Q, member 1 (Kcnq1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Kcnq1 (mGFP-tagged) - Mouse potassium voltage-gated channel, subfamily Q, member 1 (Kcnq1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Kcnq1 (GFP-tagged) - Mouse potassium voltage-gated channel, subfamily Q, member 1 (Kcnq1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, KCNQ1 (Myc-DDK tagged) - Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, KCNQ1 (mGFP-tagged) - Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, KCNQ1 (Myc-DDK tagged) - Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, KCNQ1 (mGFP-tagged) - Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Kcnq1 (Myc-DDK-tagged ORF) - Rat potassium voltage-gated channel, subfamily Q, member 1 (Kcnq1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Kcnq1 (Myc-DDK-tagged ORF) - Rat potassium voltage-gated channel, subfamily Q, member 1 (Kcnq1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Kcnq1 (Myc-DDK-tagged ORF) - Rat potassium voltage-gated channel, subfamily Q, member 1 (Kcnq1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Kcnq1 (mGFP-tagged ORF) - Rat potassium voltage-gated channel, subfamily Q, member 1 (Kcnq1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Kcnq1 (GFP-tagged ORF) - Rat potassium voltage-gated channel, subfamily Q, member 1 (Kcnq1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Kcnq1 (untagged) - Mouse potassium voltage-gated channel, subfamily Q, member 1 (Kcnq1), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
KCNQ1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human KCNQ1 |
Kcnq1 - Rat, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
Kcnq1 - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
KCNQ1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit Polyclonal Anti-KCNQ1 Antibody
| Applications | IHC, WB |
| Reactivities | Hamster, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ1 antibody: synthetic peptide directed towards the N terminal of human KCNQ1. Synthetic peptide located within the following region: RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGI |
Lenti ORF clone of Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
KCNQ1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
qSTAR qPCR primer pairs against Homo sapiens gene KCNQ1
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
KCNQ1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
KCNQ1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
KCNQ1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Kcnq1 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Purified recombinant protein of Human potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1), transcript variant 2, Ala257-End, with N-terminal His tag, expressed in E.coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
KCNQ1 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 11-42 amino acids from the N-terminal region of human KCNQ1 |
Active filters
Target Symbol
- KCNQ1