KNG1 (Myc-DDK-tagged)-Human kininogen 1 (KNG1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
KNG1 (Myc-DDK-tagged)-Human kininogen 1 (KNG1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
KNG1 (Myc-DDK-tagged)-Human kininogen 1 (KNG1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human kininogen 1 (KNG1), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
USD 820.00
3 Weeks
Lenti ORF particles, KNG1 (Myc-DDK tagged) - Human kininogen 1 (KNG1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, KNG1 (mGFP-tagged) - Human kininogen 1 (KNG1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 820.00
3 Weeks
Lenti ORF particles, KNG1 (Myc-DDK tagged) - Human kininogen 1 (KNG1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, KNG1 (mGFP-tagged) - Human kininogen 1 (KNG1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
KNG1 (Myc-DDK-tagged)-Human kininogen 1 (KNG1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
KNG1 (GFP-tagged) - Human kininogen 1 (KNG1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human kininogen 1 (KNG1), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, KNG1 (Myc-DDK tagged) - Human kininogen 1 (KNG1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human kininogen 1 (KNG1), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, KNG1 (mGFP-tagged) - Human kininogen 1 (KNG1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of KNG1 (Myc-DDK-tagged)-Human kininogen 1 (KNG1), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,000.00
6 Weeks
Lenti ORF particles, KNG1 (Myc-DDK-tagged)-Human kininogen 1 (KNG1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of KNG1 (mGFP-tagged)-Human kininogen 1 (KNG1), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,000.00
6 Weeks
Lenti ORF particles, KNG1 (mGFP-tagged)-Human kininogen 1 (KNG1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human kininogen 1 (KNG1), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, KNG1 (Myc-DDK tagged) - Human kininogen 1 (KNG1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human kininogen 1 (KNG1), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, KNG1 (mGFP-tagged) - Human kininogen 1 (KNG1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
KNG1 (GFP-tagged) - Human kininogen 1 (KNG1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
KNG1 (GFP-tagged) - Human kininogen 1 (KNG1), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human kininogen 1 (KNG1), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit anti-KNG1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Mouse, Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human KNG1 |
Rabbit Polyclonal antibody to Kininogen 1 (kininogen 1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 416 of HMW Kininogen |
KNG1 (untagged)-Human kininogen 1 (KNG1), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Kininogen 1 (KNG1) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 145-174 amino acids from the N-terminal region of Human Kininogen-1 |
Lenti ORF clone of Human kininogen 1 (KNG1), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human kininogen 1 (KNG1), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
KNG1 (untagged)-Human kininogen 1 (KNG1), transcript variant 2
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Kininogen 1 (KNG1) (LMW Isoform) goat polyclonal antibody, Serum
Applications | ID, IP |
Reactivities | Human |
Immunogen | Highly purified Molecular Weight Kininogen isolated from pooled plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Kininogen 1 (KNG1) goat polyclonal antibody, Serum
Applications | ID, IP |
Reactivities | Human |
Immunogen | Purified Kininogen from pooled Human plasma is used for the immunization. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
KNG1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Transient overexpression lysate of kininogen 1 (KNG1), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Transient overexpression lysate of kininogen 1 (KNG1), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
KNG1 (untagged)-Human kininogen 1 (KNG1), transcript variant 2
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit polyclonal KNG1 (heavy chain, Cleaved-Lys380) antibody
Applications | WB |
Reactivities | Human:Lys380 |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human KNG1. |
Anti-KNG1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 280 amino acids of human kininogen 1 |
Goat Anti-kininogen 1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RITEATKTVGSDT, from the internal region (near N terminus) of the protein sequence according to NP_001095886.1; NP_000884.1; NP_001159923.1. |
Goat Anti-kininogen 1 (aa268-279) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-PRDIPTNSPELE, from the internal region of the protein sequence according to NP_001095886.1; NP_000884.1; NP_001159923.1. |
Rabbit Polyclonal Anti-KNG1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KNG1 antibody: synthetic peptide directed towards the middle region of human KNG1. Synthetic peptide located within the following region: YPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFK |
KNG1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
KNG1 MS Standard C13 and N15-labeled recombinant protein (NP_000884)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
KNG1 (untagged)-Human kininogen 1 (KNG1) transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
KNG1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human KNG1 |
Transient overexpression of KNG1 (NM_000893) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of KNG1 (NM_001102416) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of KNG1 (NM_001166451) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human kininogen 1 (KNG1), transcript variant 2
Tag | C-His |
Expression Host | HEK293 |