Germany
Japan
United Kingdom
China
LYN (Myc-DDK-tagged)-Human v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (LYN), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
LYN (Myc-DDK-tagged)-Human v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (LYN), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
LYN (GFP-tagged) - Human v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (LYN), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
LYN (untagged)-Human v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (LYN), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SC108492 is the updated version of SC108490.
Lenti ORF particles, LYN (Myc-DDK-tagged)-Human v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (LYN), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, LYN (mGFP-tagged)-Human v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (LYN), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti-ORF clone of LYN (Myc-DDK-tagged)-Human v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (LYN), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, LYN (Myc-DDK-tagged)-Human v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (LYN), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of LYN (mGFP-tagged)-Human v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (LYN), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, LYN (mGFP-tagged)-Human v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (LYN), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of LYN (Myc-DDK-tagged)-Human v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (LYN), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, LYN (Myc-DDK-tagged)-Human v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (LYN), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, LYN (mGFP-tagged)-Human v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (LYN), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
LYN Mutant (Y306X), Myc-DDK-tagged ORF clone of Homo sapiens v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (LYN), transcript variant 1 as transfection-ready DNA
| Mutation | Y306X |
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
LYN (GFP-tagged) - Human v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (LYN), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of LYN (mGFP-tagged)-Human v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (LYN), transcript variant 1
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti-ORF clone of LYN (mGFP-tagged)-Human v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (LYN), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti-ORF clone of LYN (Myc-DDK-tagged)-Human v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (LYN), transcript variant 1
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
LYN (untagged)-Kinase deficient mutant (K275M) of Human v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (LYN), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal LYN Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This LYN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 32-62 amino acids from the N-terminal region of human LYN. |
LYN (untagged)-Human v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (LYN), transcript variant 2
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
LYN (untagged)-Kinase deficient mutant (K275M) of Human v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (LYN), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Lyn (Tyr507) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Lyn around the phosphorylation site of Tyrosine 507 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Lyn Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
LYN HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (LYN), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal Lyn Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Lyn |
Purified recombinant protein of Human tyrosine-protein kinase Lyn isoform A (LYN), Gly8-Asp238, with N-terminal HIS tag, expressed in E. coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Goat Polyclonal Antibody against LYN
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KTQPVRNTERT, from the internal region of the protein sequence according to NP_002341.1. |
Rabbit Polyclonal Anti-LYN Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LYN antibody: synthetic peptide directed towards the N terminal of human LYN. Synthetic peptide located within the following region: DPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSF |
LYN (1-512, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
LYN (1-512, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
LYN MS Standard C13 and N15-labeled recombinant protein (NP_001104567)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of LYN (NM_002350) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of LYN (NM_001111097) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of LYN (NM_002350) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of LYN (NM_002350) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of LYN (NM_001111097) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of LYN (NM_001111097) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- LYN
Families
- Druggable Genome