MASTL (Myc-DDK-tagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MASTL (Myc-DDK-tagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human microtubule associated serine/threonine kinase-like (MASTL)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, MASTL (Myc-DDK tagged) - Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, MASTL (mGFP-tagged) - Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
MASTL (Myc-DDK-tagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MASTL (GFP-tagged) - Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MASTL (Myc-DDK tagged) - Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MASTL (mGFP-tagged) - Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
MASTL (Myc-DDK-tagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of MASTL (Myc-DDK-tagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MASTL (Myc-DDK-tagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of MASTL (mGFP-tagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MASTL (mGFP-tagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of MASTL (Myc-DDK-tagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MASTL (Myc-DDK-tagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of MASTL (mGFP-tagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MASTL (mGFP-tagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
MASTL Mutant (E167D), Myc-DDK-tagged ORF clone of Homo sapiens microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2 as transfection-ready DNA
Mutation | E167D |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MASTL (GFP-tagged) - Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
MASTL (GFP-tagged) - Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
MASTL (untagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression lysate of microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
MASTL (untagged)-Kinase deficient mutant (K62M) of Human microtubule associated serine/threonine kinase-like (MASTL)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-MASTL antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human MASTL. |
MASTL HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Mouse monoclonal MASTL Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal anti-MASTL antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human MASTL. |
Rabbit Polyclonal Anti-MASTL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MASTL antibody: synthetic peptide directed towards the C terminal of human MASTL. Synthetic peptide located within the following region: NKENIVNSFTDKQQTPEKLPIPMIAKNLMCELDEDCEKNSKRDYLSSSFL |
MASTL MS Standard C13 and N15-labeled recombinant protein (NP_116233)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
MASTL (untagged)-Human microtubule associated serine/threonine kinase-like (MASTL) transcript variant 3
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
MASTL (untagged)-Human microtubule associated serine/threonine kinase-like (MASTL) transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression of MASTL (NM_032844) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MASTL (NM_001172304) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MASTL (NM_001172303) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MASTL (NM_032844) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MASTL (NM_032844) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of MASTL (NM_001172304) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of MASTL (NM_001172303) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MASTL (NM_001172303) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack