Products

View as table Download

MASTL (Myc-DDK-tagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, MASTL (Myc-DDK tagged) - Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, MASTL (mGFP-tagged) - Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

MASTL (Myc-DDK-tagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

MASTL (GFP-tagged) - Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MASTL (Myc-DDK tagged) - Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MASTL (mGFP-tagged) - Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

MASTL (Myc-DDK-tagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of MASTL (Myc-DDK-tagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MASTL (Myc-DDK-tagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of MASTL (mGFP-tagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MASTL (mGFP-tagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of MASTL (Myc-DDK-tagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MASTL (Myc-DDK-tagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of MASTL (mGFP-tagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MASTL (mGFP-tagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

MASTL Mutant (E167D), Myc-DDK-tagged ORF clone of Homo sapiens microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2 as transfection-ready DNA

Mutation E167D
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

MASTL (GFP-tagged) - Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

MASTL (GFP-tagged) - Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

MASTL (untagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Transient overexpression lysate of microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Lenti ORF clone of Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

MASTL (untagged)-Kinase deficient mutant (K62M) of Human microtubule associated serine/threonine kinase-like (MASTL)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit polyclonal anti-MASTL antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human MASTL.

MASTL HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit polyclonal anti-MASTL antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human MASTL.

Rabbit Polyclonal Anti-MASTL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MASTL antibody: synthetic peptide directed towards the C terminal of human MASTL. Synthetic peptide located within the following region: NKENIVNSFTDKQQTPEKLPIPMIAKNLMCELDEDCEKNSKRDYLSSSFL

MASTL MS Standard C13 and N15-labeled recombinant protein (NP_116233)

Tag C-Myc/DDK
Expression Host HEK293

MASTL (untagged)-Human microtubule associated serine/threonine kinase-like (MASTL) transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

MASTL (untagged)-Human microtubule associated serine/threonine kinase-like (MASTL) transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Transient overexpression of MASTL (NM_032844) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of MASTL (NM_001172304) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of MASTL (NM_001172303) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of MASTL (NM_032844) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of MASTL (NM_032844) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of MASTL (NM_001172304) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of MASTL (NM_001172303) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of MASTL (NM_001172303) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack