Products

cDNA Clones (8)
Antibodies (6)
Proteins (5)
Jump to Filters
View as table Download
COUP TF1 (NR2F1) (NM_005654) Human Tagged ORF Clone
RG203924

USD 460.00

In Stock

NR2F1 (GFP-tagged) - Human nuclear receptor subfamily 2, group F, member 1 (NR2F1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
COUP TF1 (NR2F1) (NM_005654) Human Tagged ORF Clone
RC203924

USD 420.00

In Stock

NR2F1 (Myc-DDK-tagged)-Human nuclear receptor subfamily 2, group F, member 1 (NR2F1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
COUP TF1 (NR2F1) (NM_005654) Human Untagged Clone
SC116616

USD 310.00

In Stock

NR2F1 (untagged)-Human nuclear receptor subfamily 2, group F, member 1 (NR2F1)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
COUP TF1 (NR2F1) (NM_005654) Human Tagged ORF Clone
RC203924L3

USD 620.00

3 Weeks

Lenti-ORF clone of NR2F1 (Myc-DDK-tagged)-Human nuclear receptor subfamily 2, group F, member 1 (NR2F1)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
COUP TF1 (NR2F1) (NM_005654) Human Tagged ORF Clone Lentiviral Particle
RC203924L3V

USD 820.00

6 Weeks

Lenti ORF particles, NR2F1 (Myc-DDK-tagged)-Human nuclear receptor subfamily 2, group F, member 1 (NR2F1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
COUP TF1 (NR2F1) (NM_005654) Human Tagged ORF Clone
RC203924L4

USD 620.00

3 Weeks

Lenti-ORF clone of NR2F1 (mGFP-tagged)-Human nuclear receptor subfamily 2, group F, member 1 (NR2F1)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
COUP TF1 (NR2F1) (NM_005654) Human Untagged Clone
SC322735

USD 310.00

In Stock

NR2F1 (untagged)-Human nuclear receptor subfamily 2, group F, member 1 (NR2F1)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
COUP TF1 (NR2F1) Rabbit Polyclonal Antibody
TA308523

USD 415.00

2 Weeks

Rabbit Polyclonal antibody to COUP TF1 (nuclear receptor subfamily 2, group F, member 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 44 of COUP TF1 (Uniprot ID#P10589)
COUP TF1 (NR2F1) Rabbit Polyclonal Antibody
TA346488

USD 475.00

5 Days

Rabbit Polyclonal Anti-NR2F1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR2F1 antibody: synthetic peptide directed towards the C terminal of human NR2F1. Synthetic peptide located within the following region: VLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLP
COUP TF1 (NR2F1) Rabbit Polyclonal Antibody
TA324541

USD 450.00

5 Days

Rabbit polyclonal NR2F1 Antibody (N-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This NR2F1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 48-76 amino acids from the N-terminal region of human NR2F1.
COUP TF1 (NR2F1) Rabbit Polyclonal Antibody
TA338145

USD 375.00

5 Days

Rabbit Polyclonal Anti-NR2F1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NR2F1 antibody: synthetic peptide directed towards the N terminal of human NR2F1. Synthetic peptide located within the following region: GEQQQQAGSGAPHTPQTPGQPGAPATPGTAGDKGQGPPGSGQSQQHIECV
COUP TF1 (NR2F1) Rabbit Polyclonal Antibody
TA338146

USD 375.00

5 Days

Rabbit Polyclonal Anti-NR2F1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR2F1 antibody: synthetic peptide directed towards the N terminal of human NR2F1. Synthetic peptide located within the following region: GEQQQQAGSGAPHTPQTPGQPGAPATPGTAGDKGQGPPGSGQSQQHIECV
COUP TF1 (NR2F1) (NM_005654) Human Mass Spec Standard
PH303924

USD 2,055.00

3 Weeks

NR2F1 MS Standard C13 and N15-labeled recombinant protein (NP_005645)

Tag C-Myc/DDK
Expression Host HEK293
COUP TF1 (NR2F1) Rabbit Polyclonal Antibody
TA356214

USD 360.00

5 Days

NR2F1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human NR2F1
COUP TF1 (NR2F1) ICC Control Block
TB403924

USD 1,070.00

4 Weeks

Transient overexpression of NR2F1 (NM_005654) in HEK293T cells paraffin embedded controls for ICC/IHC staining

COUP TF1 (NR2F1) Cytosection
TS403924

USD 225.00

4 Weeks

Transient overexpression of NR2F1 (NM_005654) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

COUP TF1 (NR2F1) Cytosection
TS403924P5

USD 889.00

4 Weeks

Transient overexpression of NR2F1 (NM_005654) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack