Germany
Japan
United Kingdom
China
Nr2f1 (Myc-DDK-tagged) - Mouse nuclear receptor subfamily 2, group F, member 1 (Nr2f1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadNR2F1 (GFP-tagged) - Human nuclear receptor subfamily 2, group F, member 1 (NR2F1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Recombinant protein of human nuclear receptor subfamily 2, group F, member 1 (NR2F1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF particles, Nr2f1 (Myc-DDK-tagged) - Mouse nuclear receptor subfamily 2, group F, member 1 (Nr2f1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, Nr2f1 (GFP-tagged) - Mouse nuclear receptor subfamily 2, group F, member 1 (Nr2f1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
NR2F1 (Myc-DDK-tagged)-Human nuclear receptor subfamily 2, group F, member 1 (NR2F1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NR2F1 (untagged)-Human nuclear receptor subfamily 2, group F, member 1 (NR2F1)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Nr2f1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN511206 is the updated version of KN311206.
Nr2f1 (GFP-tagged) - Mouse nuclear receptor subfamily 2 group F member 1 (Nr2f1), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Nr2f1 (Myc-DDK-tagged) - Mouse nuclear receptor subfamily 2, group F, member 1 (Nr2f1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Nr2f1 (Myc-DDK-tagged) - Mouse nuclear receptor subfamily 2, group F, member 1 (Nr2f1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, Nr2f1 (GFP-tagged) - Mouse nuclear receptor subfamily 2, group F, member 1 (Nr2f1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of NR2F1 (Myc-DDK-tagged)-Human nuclear receptor subfamily 2, group F, member 1 (NR2F1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, NR2F1 (Myc-DDK-tagged)-Human nuclear receptor subfamily 2, group F, member 1 (NR2F1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of NR2F1 (mGFP-tagged)-Human nuclear receptor subfamily 2, group F, member 1 (NR2F1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, NR2F1 (mGFP-tagged)-Human nuclear receptor subfamily 2, group F, member 1 (NR2F1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Nr2f1 (Myc-DDK-tagged ORF) - Rat nuclear receptor subfamily 2, group F, member 1 (Nr2f1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Nr2f1 (Myc-DDK-tagged ORF) - Rat nuclear receptor subfamily 2, group F, member 1 (Nr2f1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Nr2f1 (Myc-DDK-tagged ORF) - Rat nuclear receptor subfamily 2, group F, member 1 (Nr2f1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Nr2f1 (mGFP-tagged ORF) - Rat nuclear receptor subfamily 2, group F, member 1 (Nr2f1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Nr2f1 (GFP-tagged ORF) - Rat nuclear receptor subfamily 2, group F, member 1 (Nr2f1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Nr2f1 (Myc-DDK-tagged) - Mouse nuclear receptor subfamily 2, group F, member 1 (Nr2f1)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Nr2f1 (mGFP-tagged) - Mouse nuclear receptor subfamily 2, group F, member 1 (Nr2f1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
NR2F1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Nr2f1 (untagged) - Mouse nuclear receptor subfamily 2, group F, member 1 (Nr2f1), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
NR2F1 (untagged)-Human nuclear receptor subfamily 2, group F, member 1 (NR2F1)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal antibody to COUP TF1 (nuclear receptor subfamily 2, group F, member 1)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 44 of COUP TF1 (Uniprot ID#P10589) |
Rabbit Polyclonal Anti-NR2F1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR2F1 antibody: synthetic peptide directed towards the C terminal of human NR2F1. Synthetic peptide located within the following region: VLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLP |
qSTAR qPCR primer pairs against Homo sapiens gene NR2F1
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Lenti ORF clone of Nr2f1 (mGFP-tagged) - Mouse nuclear receptor subfamily 2, group F, member 1 (Nr2f1)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
NR2F1 - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
NR2F1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
Nr2f1 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Rabbit polyclonal NR2F1 Antibody (N-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NR2F1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 48-76 amino acids from the N-terminal region of human NR2F1. |
Rabbit Polyclonal Anti-NR2F1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR2F1 antibody: synthetic peptide directed towards the N terminal of human NR2F1. Synthetic peptide located within the following region: GEQQQQAGSGAPHTPQTPGQPGAPATPGTAGDKGQGPPGSGQSQQHIECV |
Rabbit Polyclonal Anti-NR2F1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR2F1 antibody: synthetic peptide directed towards the N terminal of human NR2F1. Synthetic peptide located within the following region: GEQQQQAGSGAPHTPQTPGQPGAPATPGTAGDKGQGPPGSGQSQQHIECV |
Nr2f1 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
NR2F1 CRISPRa kit - CRISPR gene activation of human nuclear receptor subfamily 2 group F member 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Nr2f1 CRISPRa kit - CRISPR gene activation of mouse nuclear receptor subfamily 2, group F, member 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene NR2F1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene NR2F1
qSTAR qPCR primer pairs against Mus musculus gene Nr2f1
NR2F1 MS Standard C13 and N15-labeled recombinant protein (NP_005645)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Nr2f1 (untagged ORF) - Rat nuclear receptor subfamily 2, group F, member 1 (Nr2f1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of nuclear receptor subfamily 2 group F member 1 (NR2F1) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Nr2f1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Nr2f1 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
NR2F1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human NR2F1 |
NR2F1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of human NR2F1 |
Active filters
Target Symbol
- NR2F1