Germany
Japan
United Kingdom
China
NUDT9 (Myc-DDK-tagged)-Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
NUDT9 (Myc-DDK-tagged)-Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Lenti ORF particles, NUDT9 (Myc-DDK tagged) - Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, NUDT9 (mGFP-tagged) - Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
NUDT9 (GFP-tagged) - Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NUDT9 (GFP-tagged) - Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NUDT9 (Myc-DDK tagged) - Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NUDT9 (mGFP-tagged) - Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NUDT9 (Myc-DDK tagged) - Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NUDT9 (mGFP-tagged) - Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
NUDT9 (Myc-DDK tagged) - Homo sapiens nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NUDT9 (GFP-tagged) - Homo sapiens nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
NUDT9 (untagged)-Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
NUDT9 (untagged)-Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 3
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-NUDT9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NUDT9 antibody: synthetic peptide directed towards the N terminal of human NUDT9. Synthetic peptide located within the following region: MSGSNGSKENSHNKARTSPYPGSKVERSQVPNEKVGWLVEWQDYKPVEYT |
NUDT9 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-NUDT9 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NUDT9 antibody: synthetic peptide directed towards the C terminal of human NUDT9. Synthetic peptide located within the following region: LEAGDDAGKVKWVDINDKLKLYASHSQFIKLVAEKRDAHWSEDSEADCHA |
Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal Anti-NUDT9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NUDT9 antibody: synthetic peptide directed towards the N terminal of human NUDT9. Synthetic peptide located within the following region: SPKFNEKDGHVERKSKNGLYEIENGRPRNPAGRTGLVGRGLLGRWGPNHA |
NUDT9 / NUDT10 (47-350, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
NUDT9 / NUDT10 (47-350, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) NUDT9 mouse monoclonal antibody, clone OTI 7F12 (formerly 7F12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NUDT9 mouse monoclonal antibody, clone OTI5B5 (formerly 5B5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NUDT9 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
NUDT9 MS Standard C13 and N15-labeled recombinant protein (NP_932155)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
NUDT9 MS Standard C13 and N15-labeled recombinant protein (NP_076952)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
NUDT9 (untagged) - Homo sapiens nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
NUDT9 mouse monoclonal antibody, clone OTI 7F12 (formerly 7F12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
NUDT9 mouse monoclonal antibody, clone OTI 7F12 (formerly 7F12), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
NUDT9 mouse monoclonal antibody, clone OTI 7F12 (formerly 7F12), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
NUDT9 mouse monoclonal antibody, clone OTI 7F12 (formerly 7F12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NUDT9 mouse monoclonal antibody, clone OTI5B5 (formerly 5B5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
NUDT9 mouse monoclonal antibody, clone OTI5B5 (formerly 5B5), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
NUDT9 mouse monoclonal antibody, clone OTI5B5 (formerly 5B5), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
NUDT9 mouse monoclonal antibody, clone OTI5B5 (formerly 5B5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
Transient overexpression of NUDT9 (NM_198038) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Active filters
Target Symbol
- NUDT9
Families
- Druggable Genome