Products

cDNA Clones (36)
Antibodies (21)
Proteins (18)
RNAi (13)
Gene Expression (9)
Jump to Filters
View as table Download
NUDT9 (NM_198038) Human Tagged ORF Clone
RC200952

USD 98.00

USD 470.00

In Stock

NUDT9 (Myc-DDK-tagged)-Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
NUDT9 (NM_024047) Human Tagged ORF Clone
RC222894

USD 420.00

In Stock

NUDT9 (Myc-DDK-tagged)-Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
NUDT9 (NM_024047) Human Tagged ORF Clone Lentiviral Particle
RC222894L1V

USD 820.00

3 Weeks

Lenti ORF particles, NUDT9 (Myc-DDK tagged) - Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
NUDT9 (NM_024047) Human Tagged ORF Clone Lentiviral Particle
RC222894L2V

USD 820.00

6 Weeks

Lenti ORF particles, NUDT9 (mGFP-tagged) - Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Nudt9 (NM_028794) Mouse Tagged ORF Clone
MR205315

USD 300.00

In Stock

Nudt9 (Myc-DDK-tagged) - Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 9 (Nudt9)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
NUDT9 (NM_198038) Human Tagged ORF Clone
RG200952

USD 460.00

In Stock

NUDT9 (GFP-tagged) - Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NUDT9 (NM_024047) Human Tagged ORF Clone
RG222894

USD 460.00

In Stock

NUDT9 (GFP-tagged) - Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NUDT9 Human Gene Knockout Kit (CRISPR)
KN400952

USD 1,290.00

2 Weeks

NUDT9 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN400952 is the updated version of KN200952.
Nudt9 Mouse Gene Knockout Kit (CRISPR)
KN511335

USD 1,290.00

2 Weeks

Nudt9 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN511335 is the updated version of KN311335.
Nudt9 (BC033921) Mouse Tagged ORF Clone
MG205315

USD 330.00

3 Weeks

Nudt9 (GFP-tagged) - Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 9 (cDNA clone MGC:36314 IMAGE:5068809)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Nudt9 (NM_028794) Mouse Tagged ORF Clone
MR205315L3

USD 500.00

3 Weeks

Lenti ORF clone of Nudt9 (Myc-DDK-tagged) - Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 9 (Nudt9)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Nudt9 (NM_028794) Mouse Tagged ORF Clone Lentiviral Particle
MR205315L3V

USD 700.00

6 Weeks

Lenti ORF particles, Nudt9 (Myc-DDK-tagged) - Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 9 (Nudt9), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Nudt9 (NM_028794) Mouse Tagged ORF Clone
MR205315L4

USD 500.00

3 Weeks

Lenti ORF clone of Nudt9 (mGFP-tagged) - Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 9 (Nudt9)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Nudt9 (NM_028794) Mouse Tagged ORF Clone Lentiviral Particle
MR205315L4V

USD 700.00

6 Weeks

Lenti ORF particles, Nudt9 (GFP-tagged) - Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 9 (Nudt9), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NUDT9 (NM_198038) Human Tagged ORF Clone
RC200952L3

USD 620.00

3 Weeks

Lenti ORF clone of Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NUDT9 (NM_198038) Human Tagged ORF Clone Lentiviral Particle
RC200952L3V

USD 820.00

6 Weeks

Lenti ORF particles, NUDT9 (Myc-DDK tagged) - Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NUDT9 (NM_198038) Human Tagged ORF Clone
RC200952L4

USD 620.00

3 Weeks

Lenti ORF clone of Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NUDT9 (NM_198038) Human Tagged ORF Clone Lentiviral Particle
RC200952L4V

USD 820.00

6 Weeks

Lenti ORF particles, NUDT9 (mGFP-tagged) - Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NUDT9 (NM_024047) Human Tagged ORF Clone
RC222894L3

USD 620.00

3 Weeks

Lenti ORF clone of Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NUDT9 (NM_024047) Human Tagged ORF Clone Lentiviral Particle
RC222894L3V

USD 820.00

5 Weeks

Lenti ORF particles, NUDT9 (Myc-DDK tagged) - Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NUDT9 (NM_024047) Human Tagged ORF Clone
RC222894L4

USD 620.00

3 Weeks

Lenti ORF clone of Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NUDT9 (NM_024047) Human Tagged ORF Clone Lentiviral Particle
RC222894L4V

USD 820.00

7 Weeks

Lenti ORF particles, NUDT9 (mGFP-tagged) - Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NUDT9 (NM_001248011) Human Tagged ORF Clone
RC232467

USD 420.00

3 Weeks

NUDT9 (Myc-DDK tagged) - Homo sapiens nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
NUDT9 (NM_001248011) Human Tagged ORF Clone
RG232467

USD 460.00

3 Weeks

NUDT9 (GFP-tagged) - Homo sapiens nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Nudt9 (NM_001006991) Rat Tagged ORF Clone
RR203310

USD 420.00

4 Weeks

Nudt9 (Myc-DDK-tagged ORF) - Rat nudix (nucleoside diphosphate linked moiety X)-type motif 9 (Nudt9), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Nudt9 (NM_001006991) Rat Tagged ORF Clone
RR203310L3

USD 640.00

9 Weeks

Lenti ORF clone of Nudt9 (Myc-DDK-tagged ORF) - Rat nudix (nucleoside diphosphate linked moiety X)-type motif 9 (Nudt9), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Nudt9 (NM_001006991) Rat Tagged ORF Clone Lentiviral Particle
RR203310L3V

USD 850.00

13 Weeks

Lenti ORF particles, Nudt9 (Myc-DDK-tagged ORF) - Rat nudix (nucleoside diphosphate linked moiety X)-type motif 9 (Nudt9), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Nudt9 (NM_001006991) Rat Tagged ORF Clone
RR203310L4

USD 700.00

9 Weeks

Lenti ORF clone of Nudt9 (mGFP-tagged ORF) - Rat nudix (nucleoside diphosphate linked moiety X)-type motif 9 (Nudt9), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Nudt9 (NM_001006991) Rat Tagged ORF Clone Lentiviral Particle
RR203310L4V

USD 960.00

13 Weeks

Lenti ORF particles, Nudt9 (GFP-tagged ORF) - Rat nudix (nucleoside diphosphate linked moiety X)-type motif 9 (Nudt9), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NUDT9 (NM_024047) Human Tagged ORF Clone
RC222894L1

USD 768.00

In Stock

Lenti ORF clone of Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
NUDT9 (NM_024047) Human Untagged Clone
SC112300

USD 310.00

In Stock

NUDT9 (untagged)-Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
NUDT9 (NM_024047) Human Tagged ORF Clone
RC222894L2

USD 620.00

3 Weeks

Lenti ORF clone of Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
NUDT9 (NM_198038) Human Untagged Clone
SC319364

USD 660.00

In Stock

NUDT9 (untagged)-Human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 3

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
NUDT9 Rabbit Polyclonal Antibody
TA338790

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-NUDT9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NUDT9 antibody: synthetic peptide directed towards the N terminal of human NUDT9. Synthetic peptide located within the following region: MSGSNGSKENSHNKARTSPYPGSKVERSQVPNEKVGWLVEWQDYKPVEYT
NUDT9 Human shRNA Plasmid Kit (Locus ID 53343)
TG302846

USD 715.00

In Stock

NUDT9 - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector

Format Retroviral plasmids
Vector pGFP-V-RS
NUDT9 (C-term) Rabbit Polyclonal Antibody
AP52966PU-N

USD 450.00

2 Weeks

NUDT9 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 317-347 amino acids from the C-terminal region of Human NUDT9
NUDT9 (NM_024047) Human Over-expression Lysate
LC402975

USD 121.00

In Stock

NUDT9 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Nudt9 (NM_028794) Mouse Untagged Clone
MC204151

USD 210.00

In Stock

Nudt9 (untagged) - Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 9 (Nudt9), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
NUDT9 Rabbit Polyclonal Antibody
TA338788

USD 375.00

5 Days

Rabbit Polyclonal Anti-NUDT9 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NUDT9 antibody: synthetic peptide directed towards the C terminal of human NUDT9. Synthetic peptide located within the following region: LEAGDDAGKVKWVDINDKLKLYASHSQFIKLVAEKRDAHWSEDSEADCHA
NUDT9 (NM_198038) Human Over-expression Lysate
LY405100

USD 396.00

5 Days

Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NUDT9 Rabbit Polyclonal Antibody
TA338789

USD 375.00

5 Days

Rabbit Polyclonal Anti-NUDT9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NUDT9 antibody: synthetic peptide directed towards the N terminal of human NUDT9. Synthetic peptide located within the following region: SPKFNEKDGHVERKSKNGLYEIENGRPRNPAGRTGLVGRGLLGRWGPNHA
NUDT9 / NUDT10 (47-350, His-tag) Human Protein
AR39002PU-L

USD 845.00

2 Weeks

NUDT9 / NUDT10 (47-350, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
NUDT9 / NUDT10 (47-350, His-tag) Human Protein
AR39002PU-N

USD 330.00

2 Weeks

NUDT9 / NUDT10 (47-350, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
NUDT9 Mouse Monoclonal Antibody [Clone ID: OTI 7F12]
CF503235

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) NUDT9 mouse monoclonal antibody, clone OTI 7F12 (formerly 7F12)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
NUDT9 Mouse Monoclonal Antibody [Clone ID: OTI5B5]
CF503275

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) NUDT9 mouse monoclonal antibody, clone OTI5B5 (formerly 5B5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
NUDT9 Mouse Monoclonal Antibody [Clone ID: OTI7A12]
CF503333

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) NUDT9 mouse monoclonal antibody, clone OTI7A12 (formerly 7A12)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Human NUDT9 activation kit by CRISPRa
GA110003

USD 1,290.00

2 Weeks

NUDT9 CRISPRa kit - CRISPR gene activation of human nudix hydrolase 9

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Nudt9 activation kit by CRISPRa
GA209758

USD 1,290.00

2 Weeks

Nudt9 CRISPRa kit - CRISPR gene activation of mouse nudix (nucleoside diphosphate linked moiety X)-type motif 9

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
NUDT9 Human qPCR Template Standard (NM_024047)
HK205260

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene NUDT9

Application Plasmid of exact quantity for transcript copy number calculation