Products

cDNA Clones (16)
Antibodies (13)
Proteins (12)
Jump to Filters
View as table Download
Perilipin-1 (PLIN1) (NM_001145311) Human Tagged ORF Clone
RC226949

USD 420.00

In Stock

PLIN1 (Myc-DDK-tagged)-Human perilipin 1 (PLIN1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Perilipin-1 (PLIN1) Guinea Pig Polyclonal Antibody
BP5015

USD 400.00

2 Weeks

Perilipin-1 (PLIN1) guinea pig polyclonal antibody, Serum

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen Duplicated N-terminus of Perilipin, aa 1-20 (cf. Greenberg et al. 1992, JBC 266, 11341-11346)
Perilipin-1 (PLIN1) (NM_002666) Human Untagged Clone
SC118500

USD 310.00

In Stock

PLIN1 (untagged)-Human perilipin 1 (PLIN1), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Perilipin-1 (PLIN1) (NM_002666) Human Tagged ORF Clone
RG206292

USD 460.00

3 Weeks

PLIN1 (GFP-tagged) - Human perilipin 1 (PLIN1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Perilipin-1 (PLIN1) (NM_001145311) Human Tagged ORF Clone
RG226949

USD 460.00

3 Weeks

PLIN1 (GFP-tagged) - Human perilipin 1 (PLIN1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Perilipin-1 (PLIN1) Mouse Monoclonal Antibody [Clone ID: PERI112.17]
AM09128SU-N

USD 320.00

2 Weeks

Perilipin-1 (PLIN1) mouse monoclonal antibody, clone PERI112.17, Supernatant

Applications IF, IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Perilipin-1 (PLIN1) Rabbit Polyclonal Antibody
TA319013

USD 355.00

3 Weeks

Rabbit polyclonal anti-Perilipin A antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 510 of mouse Perilipin A.
Perilipin-1 (PLIN1) (NM_001145311) Human Over-expression Lysate
LY428814

USD 396.00

In Stock

Transient overexpression lysate of perilipin 1 (PLIN1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Perilipin-1 (PLIN1) (488-499) Goat Polyclonal Antibody
AP22521PU-N

USD 440.00

2 Weeks

Perilipin-1 (PLIN1) (488-499) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Monkey
Immunogen Synthetic peptide from internal region of human PLIN
Perilipin-1 (PLIN1) (NM_002666) Human Over-expression Lysate
LY419173

USD 396.00

In Stock

Transient overexpression lysate of perilipin 1 (PLIN1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Perilipin-1 (PLIN1) Rabbit Polyclonal Antibody
TA309806

USD 457.00

5 Days

Rabbit Polyclonal Perilipin Antibody

Applications WB
Reactivities Bovine, Human, Mouse, Porcine, Rat, Sheep
Conjugation Unconjugated
Immunogen A synthetic peptide made to a region between residues 450-522 (C-terminus) of the human perilipin protein. [Swiss-Prot# O60240]
Perilipin-1 (PLIN1) Rabbit Polyclonal Antibody
TA346328

USD 410.00

5 Days

Rabbit Polyclonal Anti-PLIN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLIN antibody: synthetic peptide directed towards the N terminal of human PLIN. Synthetic peptide located within the following region: STQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTISTRLRSARNS
Perilipin-1 (PLIN1) (C-term) Goat Polyclonal Antibody
AP22522PU-N

USD 440.00

2 Weeks

Perilipin-1 (PLIN1) (C-term) goat polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Bovine, Canine, Equine, Human, Monkey, Mouse
Immunogen Synthetic peptide from (C-term) of human PLIN
Perilipin-1 (PLIN1) (NM_002666) Human Tagged ORF Clone
RC206292L2

USD 620.00

3 Weeks

Lenti ORF clone of Human perilipin 1 (PLIN1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Perilipin-1 (PLIN1) (C-term) Guinea Pig Polyclonal Antibody
BP5033

USD 395.00

2 Weeks

Perilipin-1 (PLIN1) (C-term) guinea pig polyclonal antibody, Serum

Applications IHC, WB
Reactivities Bovine, Human
Immunogen C-terminus of Perilipin-1 (hCTA/B; aa 507-519; cf. Greenberg et al. 1992, JBC 266, 11341-11346)
Perilipin-1 (PLIN1) (NM_002666) Human Over-expression Lysate
LC419173

USD 121.00

In Stock

PLIN1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Perilipin-1 (PLIN1) (NM_001145311) Human Over-expression Lysate
LC428814

USD 121.00

In Stock

PLIN1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Perilipin-1 (PLIN1) Goat Polyclonal Antibody
TA303218

USD 375.00

5 Days

Goat Polyclonal Antibody against PLIN

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-PREKPKRRVSDS, from the internal region (near the C Terminus) of the protein sequence according to NP_002657.2.
Perilipin-1 (PLIN1) Goat Polyclonal Antibody
TA303219

USD 375.00

5 Days

Goat Polyclonal Antibody against PLIN (C-terminal)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EPILGRAQYSQLRKK, from the C Terminus of the protein sequence according to NP_002657.2.
Perilipin-1 (PLIN1) (NM_002666) Human Mass Spec Standard
PH306292

USD 2,055.00

3 Weeks

PLIN1 MS Standard C13 and N15-labeled recombinant protein (NP_002657)

Tag C-Myc/DDK
Expression Host HEK293
Perilipin-1 (PLIN1) (NM_001145311) Human Untagged Clone
SC325156

USD 760.00

3 Weeks

PLIN1 (untagged)-Human perilipin 1 (PLIN1), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Perilipin-1 (PLIN1) Rabbit Polyclonal Antibody
TA351513

USD 345.00

In Stock

Rabbit Polyclonal Anti-PLIN1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PLIN1
Perilipin-1 (PLIN1) Rabbit Polyclonal Antibody
TA351514

USD 345.00

In Stock

Rabbit Polyclonal Anti-PLIN1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PLIN1
Perilipin-1 (PLIN1) Rabbit Polyclonal Antibody
TA351515

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-PLIN1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PLIN1
Perilipin-1 (PLIN1) ICC Control Block
TB406292

USD 1,070.00

4 Weeks

Transient overexpression of PLIN1 (NM_002666) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Perilipin-1 (PLIN1) ICC Control Block
TB426949

USD 1,070.00

4 Weeks

Transient overexpression of PLIN1 (NM_001145311) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Perilipin-1 (PLIN1) Cytosection
TS406292

USD 225.00

4 Weeks

Transient overexpression of PLIN1 (NM_002666) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Perilipin-1 (PLIN1) Cytosection
TS406292P5

USD 889.00

4 Weeks

Transient overexpression of PLIN1 (NM_002666) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Perilipin-1 (PLIN1) Cytosection
TS426949

USD 225.00

4 Weeks

Transient overexpression of PLIN1 (NM_001145311) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Perilipin-1 (PLIN1) Cytosection
TS426949P5

USD 889.00

4 Weeks

Transient overexpression of PLIN1 (NM_001145311) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack