Germany
Japan
United Kingdom
China
PPARGC1A (Myc-DDK-tagged)-Human peroxisome proliferator-activated receptor gamma, coactivator 1 alpha (PPARGC1A)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadPPARGC1A (untagged)-Human peroxisome proliferator-activated receptor gamma, coactivator 1 alpha (PPARGC1A)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
PPARGC1A (GFP-tagged) - Human peroxisome proliferator-activated receptor gamma, coactivator 1 alpha (PPARGC1A)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 1,010.00
3 Weeks
Lenti ORF particles, PPARGC1A (mGFP-tagged) - Human peroxisome proliferator-activated receptor gamma, coactivator 1 alpha (PPARGC1A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
USD 1,010.00
3 Weeks
Lenti ORF particles, PPARGC1A (Myc-DDK tagged) - Human peroxisome proliferator-activated receptor gamma, coactivator 1 alpha (PPARGC1A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 1,010.00
3 Weeks
Lenti ORF particles, PPARGC1A (Myc-DDK tagged) - Human peroxisome proliferator-activated receptor gamma, coactivator 1 alpha (PPARGC1A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 1,010.00
3 Weeks
Lenti ORF particles, PPARGC1A (mGFP-tagged) - Human peroxisome proliferator-activated receptor gamma, coactivator 1 alpha (PPARGC1A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A. |
Rabbit polyclonal anti-PGC-1alpha antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 766 of mouse PGC-1alpha |
Rabbit Polyclonal Anti-PPARGC1A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARGC1A antibody: synthetic peptide directed towards the N terminal of human PPARGC1A. Synthetic peptide located within the following region: MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDS |
Lenti ORF clone of Human peroxisome proliferator-activated receptor gamma, coactivator 1 alpha (PPARGC1A), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal anti-PPARGC1A antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARGC1A antibody: synthetic peptide directed towards the N terminal of human PPARGC1A. Synthetic peptide located within the following region: PSFDALTDGDVTTDNEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQL |
Purified recombinant protein of Human peroxisome proliferator-activated receptor gamma, coactivator 1 alpha (PPARGC1A), Phe511-End, with N-terminal His tag, expressed in E.coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Rabbit Polyclonal Anti-PPARGC1A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PPARGC1A |
Transient overexpression of PPARGC1A (NM_013261) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PPARGC1A (NM_013261) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PPARGC1A (NM_013261) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PPARGC1A
Families
- Druggable Genome