Germany
Japan
United Kingdom
China
PPARGC1A (Myc-DDK-tagged)-Human peroxisome proliferator-activated receptor gamma, coactivator 1 alpha (PPARGC1A)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadPpargc1a (Myc-DDK-tagged) - Mouse peroxisome proliferative activated receptor, gamma, coactivator 1 alpha (Ppargc1a), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PPARGC1A (untagged)-Human peroxisome proliferator-activated receptor gamma, coactivator 1 alpha (PPARGC1A)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Ppargc1a (untagged) - Mouse peroxisome proliferative activated receptor, gamma, coactivator 1 alpha (Ppargc1a), transcript variant 1, (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PPARGC1A (GFP-tagged) - Human peroxisome proliferator-activated receptor gamma, coactivator 1 alpha (PPARGC1A)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 1,010.00
3 Weeks
Lenti ORF particles, PPARGC1A (mGFP-tagged) - Human peroxisome proliferator-activated receptor gamma, coactivator 1 alpha (PPARGC1A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, Ppargc1a (Myc-DDK-tagged) - Mouse peroxisome proliferative activated receptor, gamma, coactivator 1 alpha (Ppargc1a), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, Ppargc1a (GFP-tagged) - Mouse peroxisome proliferative activated receptor, gamma, coactivator 1 alpha (Ppargc1a), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
USD 1,010.00
3 Weeks
Lenti ORF particles, PPARGC1A (Myc-DDK tagged) - Human peroxisome proliferator-activated receptor gamma, coactivator 1 alpha (PPARGC1A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, Ppargc1a (Myc-DDK-tagged ORF) - Rat peroxisome proliferator-activated receptor gamma, coactivator 1 alpha (Ppargc1a), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, Ppargc1a (GFP-tagged ORF) - Rat peroxisome proliferator-activated receptor gamma, coactivator 1 alpha (Ppargc1a), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Ppargc1a (GFP-tagged) - Mouse peroxisome proliferative activated receptor, gamma, coactivator 1 alpha (Ppargc1a)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, Ppargc1a (GFP-tagged) - Mouse peroxisome proliferative activated receptor, gamma, coactivator 1 alpha (Ppargc1a), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PPARGC1A - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
PPARGC1A - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN412244 is the updated version of KN212244.
Ppargc1a - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN513676 is the updated version of KN313676.
Lenti ORF clone of Ppargc1a (Myc-DDK-tagged) - Mouse peroxisome proliferative activated receptor, gamma, coactivator 1 alpha (Ppargc1a), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ppargc1a (Myc-DDK-tagged) - Mouse peroxisome proliferative activated receptor, gamma, coactivator 1 alpha (Ppargc1a), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 1,010.00
3 Weeks
Lenti ORF particles, PPARGC1A (Myc-DDK tagged) - Human peroxisome proliferator-activated receptor gamma, coactivator 1 alpha (PPARGC1A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 1,010.00
3 Weeks
Lenti ORF particles, PPARGC1A (mGFP-tagged) - Human peroxisome proliferator-activated receptor gamma, coactivator 1 alpha (PPARGC1A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Ppargc1a (Myc-DDK-tagged ORF) - Rat peroxisome proliferator-activated receptor gamma, coactivator 1 alpha (Ppargc1a), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ppargc1a (Myc-DDK-tagged ORF) - Rat peroxisome proliferator-activated receptor gamma, coactivator 1 alpha (Ppargc1a), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ppargc1a (Myc-DDK-tagged ORF) - Rat peroxisome proliferator-activated receptor gamma, coactivator 1 alpha (Ppargc1a), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ppargc1a (mGFP-tagged ORF) - Rat peroxisome proliferator-activated receptor gamma, coactivator 1 alpha (Ppargc1a), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ppargc1a (GFP-tagged ORF) - Rat peroxisome proliferator-activated receptor gamma, coactivator 1 alpha (Ppargc1a), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ppargc1a (mGFP-tagged) - Mouse peroxisome proliferative activated receptor, gamma, coactivator 1 alpha (Ppargc1a), transcript variant 1
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A. |
Rabbit polyclonal anti-PGC-1alpha antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 766 of mouse PGC-1alpha |
qSTAR qPCR primer pairs against Homo sapiens gene PPARGC1A
PPARGC1A - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Rabbit Polyclonal Anti-PPARGC1A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARGC1A antibody: synthetic peptide directed towards the N terminal of human PPARGC1A. Synthetic peptide located within the following region: MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDS |
Lenti ORF clone of Ppargc1a (Myc-DDK-tagged ORF) - Rat peroxisome proliferator-activated receptor gamma, coactivator 1 alpha (Ppargc1a), (10 ug)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human peroxisome proliferator-activated receptor gamma, coactivator 1 alpha (PPARGC1A), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-Ppargc1a Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ppargc1a antibody: synthetic peptide directed towards the middle region of mouse Ppargc1a. Synthetic peptide located within the following region: QEIRAELNKHFGHPCQAVFDDKSDKTSELRDGDFSNEQFSKLPVFINSGL |
Lenti ORF clone of Ppargc1a (mGFP-tagged) - Mouse peroxisome proliferative activated receptor, gamma, coactivator 1 alpha (Ppargc1a), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Rabbit Polyclonal Anti-Ppargc1a Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ppargc1a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LENGYTLRRSNETDFELYFCGRKQFFKSNYADLDTNSDDFDPASTKSKYD |
qSTAR qPCR primer pairs against Mus musculus gene Ppargc1a
Ppargc1a (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SR427524 is the updated version of SR420231.
Ppargc1a - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Goat Polyclonal Antibody against PPARGC1A
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DGLFDDSEDESDK, from the internal region of the protein sequence according to NP_037393.1. |
Ppargc1a - Rat, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
Lenti ORF clone of Ppargc1a (Myc-DDK-tagged) - Mouse peroxisome proliferative activated receptor, gamma, coactivator 1 alpha (Ppargc1a), transcript variant 1
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Ppargc1a (untagged ORF) - Rat peroxisome proliferator-activated receptor gamma, coactivator 1 alpha (Ppargc1a), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Ppargc1a (mGFP-tagged ORF) - Rat peroxisome proliferator-activated receptor gamma, coactivator 1 alpha (Ppargc1a), (10 ug)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal anti-PPARGC1A antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARGC1A antibody: synthetic peptide directed towards the N terminal of human PPARGC1A. Synthetic peptide located within the following region: PSFDALTDGDVTTDNEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQL |
PPARGC1A - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
PPARGC1A - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | GFP-puro |
Active filters
Target Symbol
- PPARGC1A