Products

View as table Download

PPP1CB (Myc-DDK-tagged)-Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

PPP1CB (Myc-DDK-tagged)-Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human protein phosphatase 1, catalytic subunit, beta isoform (PPP1CB), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T

Lenti ORF particles, PPP1CB (Myc-DDK tagged) - Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, PPP1CB (mGFP-tagged) - Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF particles, PPP1CB (Myc-DDK tagged) - Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, PPP1CB (mGFP-tagged) - Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

PPP1CB (GFP-tagged) - Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PPP1CB (GFP-tagged) - Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, PPP1CB (Myc-DDK tagged) - Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PPP1CB (mGFP-tagged) - Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PPP1CB (Myc-DDK tagged) - Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PPP1CB (mGFP-tagged) - Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit anti-PPP1CB Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP1CB

PPP1CB (untagged)-Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Transient overexpression lysate of protein phosphatase 1, catalytic subunit, beta isoform (PPP1CB), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

PPP1CB (untagged)-Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit polyclonal Protein Phosphatase 1 beta (PPP1CB) Antibody (C-term)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This Protein Phosphatase 1 beta (PPP1CB) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 286-315 amino acids from the C-terminal region of human Protein Phosphatase 1 beta (PPP1CB).

Transient overexpression lysate of protein phosphatase 1, catalytic subunit, beta isoform (PPP1CB), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Rabbit Polyclonal Anti-PPP1CB Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP1CB antibody is: synthetic peptide directed towards the C-terminal region of Human PPP1CB. Synthetic peptide located within the following region: LFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRP

Rabbit Polyclonal Anti-PPP1CB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP1CB antibody is: synthetic peptide directed towards the C-terminal region of Human PPP1CB. Synthetic peptide located within the following region: VPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLI

Anti-PPP1CB Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to N terminal 327 amino acids of human protein phosphatase 1, catalytic subunit, beta isozyme

Anti-PPP1CB Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to N terminal 327 amino acids of human protein phosphatase 1, catalytic subunit, beta isozyme

Transient overexpression of PPP1CB (NM_206876) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of PPP1CB (NM_002709) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of PPP1CB (NM_206876) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of PPP1CB (NM_206876) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of PPP1CB (NM_002709) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of PPP1CB (NM_002709) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack