PPP4C (Myc-DDK-tagged)-Human protein phosphatase 4, catalytic subunit (PPP4C)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
PPP4C (Myc-DDK-tagged)-Human protein phosphatase 4, catalytic subunit (PPP4C)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, PPP4C (Myc-DDK tagged) - Human protein phosphatase 4, catalytic subunit (PPP4C), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, PPP4C (mGFP-tagged) - Human protein phosphatase 4, catalytic subunit (PPP4C), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
PPP4C Rabbit Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PPP4C |
PPP4C (GFP-tagged) - Human protein phosphatase 4, catalytic subunit (PPP4C)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, PPP4C (Myc-DDK tagged) - Human protein phosphatase 4, catalytic subunit (PPP4C), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human protein phosphatase 4, catalytic subunit (PPP4C), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP4C (mGFP-tagged) - Human protein phosphatase 4, catalytic subunit (PPP4C), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human protein phosphatase 4, catalytic subunit (PPP4C), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human protein phosphatase 4, catalytic subunit (PPP4C), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
PPP4C (untagged)-Human protein phosphatase 4, catalytic subunit (PPP4C)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-PPP4C Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPP4C antibody: synthetic peptide directed towards the middle region of human PPP4C. Synthetic peptide located within the following region: TVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKP |
Purified recombinant protein of Human protein phosphatase 4, catalytic subunit (PPP4C), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
Tag | N-His |
Expression Host | E. coli |
PPP4C (290-301) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Bat, Bovine, Canine, Equine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish |
Immunogen | synthetic peptide from the C-terminus of human PPP4C (NP_002711.1) |
Lenti ORF clone of Human protein phosphatase 4, catalytic subunit (PPP4C), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Mouse Monoclonal Protein Phosphatase 4C Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PPP4C rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | A PP X/C peptide conjugated to KLH |
PPP4C sheep polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | A PP X/C peptide conjugated to KLH |
PPP4C (untagged)-Human protein phosphatase 4, catalytic subunit (PPP4C)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Goat Anti-PPP4C Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-PQETRGIPSKKP, from the C-Terminus of the protein sequence according to NP_002711.1. |
PPP4C (1-307, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
PPP4C (1-307, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) PPP4C mouse monoclonal antibody,clone OTI2H8
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPP4C mouse monoclonal antibody,clone OTI2E4
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPP4C mouse monoclonal antibody,clone OTI2H7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PPP4C mouse monoclonal antibody,clone OTI2H8
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PPP4C mouse monoclonal antibody,clone OTI2H8, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PPP4C mouse monoclonal antibody,clone OTI2H8, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PPP4C mouse monoclonal antibody,clone OTI2H8
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PPP4C mouse monoclonal antibody,clone OTI2E4
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PPP4C mouse monoclonal antibody,clone OTI2E4, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PPP4C mouse monoclonal antibody,clone OTI2E4, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PPP4C mouse monoclonal antibody,clone OTI2E4
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PPP4C mouse monoclonal antibody,clone OTI2H7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PPP4C mouse monoclonal antibody,clone OTI2H7, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PPP4C mouse monoclonal antibody,clone OTI2H7, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PPP4C mouse monoclonal antibody,clone OTI2H7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of PPP4C (NM_002720) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PPP4C (NM_002720) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PPP4C (NM_002720) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack