Products

View as table Download

USD 98.00

USD 470.00

In Stock

PPP4C (Myc-DDK-tagged)-Human protein phosphatase 4, catalytic subunit (PPP4C)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, PPP4C (Myc-DDK tagged) - Human protein phosphatase 4, catalytic subunit (PPP4C), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, PPP4C (mGFP-tagged) - Human protein phosphatase 4, catalytic subunit (PPP4C), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

PPP4C Rabbit Polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP4C

PPP4C (GFP-tagged) - Human protein phosphatase 4, catalytic subunit (PPP4C)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, PPP4C (Myc-DDK tagged) - Human protein phosphatase 4, catalytic subunit (PPP4C), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human protein phosphatase 4, catalytic subunit (PPP4C), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PPP4C (mGFP-tagged) - Human protein phosphatase 4, catalytic subunit (PPP4C), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human protein phosphatase 4, catalytic subunit (PPP4C), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

PPP4C (untagged)-Human protein phosphatase 4, catalytic subunit (PPP4C)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-PPP4C Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP4C antibody: synthetic peptide directed towards the middle region of human PPP4C. Synthetic peptide located within the following region: TVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKP

Purified recombinant protein of Human protein phosphatase 4, catalytic subunit (PPP4C), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli

PPP4C (290-301) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Bat, Bovine, Canine, Equine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish
Immunogen synthetic peptide from the C-terminus of human PPP4C (NP_002711.1)

Lenti ORF clone of Human protein phosphatase 4, catalytic subunit (PPP4C), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Mouse Monoclonal Protein Phosphatase 4C Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

PPP4C rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen A PP X/C peptide conjugated to KLH

PPP4C sheep polyclonal antibody, Purified

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen A PP X/C peptide conjugated to KLH

PPP4C (untagged)-Human protein phosphatase 4, catalytic subunit (PPP4C)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Goat Anti-PPP4C Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-PQETRGIPSKKP, from the C-Terminus of the protein sequence according to NP_002711.1.

PPP4C (1-307, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli

PPP4C (1-307, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli

Carrier-free (BSA/glycerol-free) PPP4C mouse monoclonal antibody,clone OTI2H8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PPP4C mouse monoclonal antibody,clone OTI2E4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PPP4C mouse monoclonal antibody,clone OTI2H7

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPP4C mouse monoclonal antibody,clone OTI2H8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPP4C mouse monoclonal antibody,clone OTI2H8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPP4C mouse monoclonal antibody,clone OTI2E4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPP4C mouse monoclonal antibody,clone OTI2E4, Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PPP4C mouse monoclonal antibody,clone OTI2E4, HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

PPP4C mouse monoclonal antibody,clone OTI2E4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPP4C mouse monoclonal antibody,clone OTI2H7

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPP4C mouse monoclonal antibody,clone OTI2H7

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

USD 1,120.00

4 Weeks

Transient overexpression of PPP4C (NM_002720) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of PPP4C (NM_002720) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of PPP4C (NM_002720) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack