Products

cDNA Clones (17)
Proteins (15)
Antibodies (4)
Jump to Filters
View as table Download
Proteasome 20S alpha 5 (PSMA5) (NM_002790) Human Tagged ORF Clone Lentiviral Particle
RC210717L3V

USD 820.00

6 Weeks

Lenti ORF particles, PSMA5 (Myc-DDK tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 5 (PSMA5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Proteasome 20S alpha 5 (PSMA5) (NM_002790) Human Tagged ORF Clone
RC210717L4

USD 620.00

3 Weeks

Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 5 (PSMA5), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Proteasome 20S alpha 5 (PSMA5) (NM_002790) Human Tagged ORF Clone Lentiviral Particle
RC210717L4V

USD 820.00

6 Weeks

Lenti ORF particles, PSMA5 (mGFP-tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 5 (PSMA5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Proteasome 20S alpha 5 (PSMA5) (NM_001199772) Human Tagged ORF Clone
RC231993

USD 420.00

3 Weeks

PSMA5 (Myc-DDK tagged) - Homo sapiens proteasome (prosome, macropain) subunit, alpha type, 5 (PSMA5), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Proteasome 20S alpha 5 (PSMA5) (NM_001199773) Human Tagged ORF Clone
RC231994

USD 420.00

3 Weeks

PSMA5 (Myc-DDK tagged) - Homo sapiens proteasome (prosome, macropain) subunit, alpha type, 5 (PSMA5), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Proteasome 20S alpha 5 (PSMA5) (NM_001199774) Human Tagged ORF Clone
RC231995

USD 420.00

3 Weeks

PSMA5 (Myc-DDK tagged) - Homo sapiens proteasome (prosome, macropain) subunit, alpha type, 5 (PSMA5), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Proteasome 20S alpha 5 (PSMA5) (NM_002790) Human Tagged ORF Clone
RG210717

USD 460.00

3 Weeks

PSMA5 (GFP-tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 5 (PSMA5), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Proteasome 20S alpha 5 (PSMA5) (NM_001199772) Human Tagged ORF Clone
RG231993

USD 460.00

3 Weeks

PSMA5 (GFP-tagged) - Homo sapiens proteasome (prosome, macropain) subunit, alpha type, 5 (PSMA5), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Proteasome 20S alpha 5 (PSMA5) (NM_001199773) Human Tagged ORF Clone
RG231994

USD 460.00

3 Weeks

PSMA5 (GFP-tagged) - Homo sapiens proteasome (prosome, macropain) subunit, alpha type, 5 (PSMA5), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Proteasome 20S alpha 5 (PSMA5) (NM_001199774) Human Tagged ORF Clone
RG231995

USD 460.00

3 Weeks

PSMA5 (GFP-tagged) - Homo sapiens proteasome (prosome, macropain) subunit, alpha type, 5 (PSMA5), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Proteasome 20S alpha 5 (PSMA5) Rabbit Polyclonal Antibody
TA332887

USD 275.00

3 Weeks

Rabbit anti-PSMA5 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PSMA5
Proteasome 20S alpha 5 (PSMA5) (NM_002790) Human Over-expression Lysate
LC419118

USD 121.00

In Stock

PSMA5 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Proteasome 20S alpha 5 (PSMA5) (NM_002790) Human Over-expression Lysate
LY419118

USD 396.00

In Stock

Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 5 (PSMA5)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Proteasome 20S alpha 5 (PSMA5) (NM_002790) Human Untagged Clone
SC118413

USD 420.00

In Stock

PSMA5 (untagged)-Human proteasome (prosome, macropain) subunit, alpha type, 5 (PSMA5), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Proteasome 20S alpha 5 (PSMA5) (NM_002790) Human Untagged Clone
SC322079

USD 420.00

In Stock

PSMA5 (untagged)-Human proteasome (prosome, macropain) subunit, alpha type, 5 (PSMA5), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Proteasome 20S alpha 5 (PSMA5) Rabbit Polyclonal Antibody
TA342161

USD 375.00

5 Days

Rabbit polyclonal Anti-PSMA5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMA5 antibody: synthetic peptide directed towards the N terminal of human PSMA5. Synthetic peptide located within the following region: MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAV
Proteasome 20S alpha 5 (PSMA5) Rabbit Polyclonal Antibody
TA342162

USD 375.00

5 Days

Rabbit polyclonal Anti-PSMA5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMA5 antibody: synthetic peptide directed towards the middle region of human PSMA5. Synthetic peptide located within the following region: FGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLK
PSMA5 (1-241, His-tag) Human Protein
AR50161PU-N

USD 845.00

2 Weeks

PSMA5 (1-241, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
PSMA5 (1-241, His-tag) Human Protein
AR50161PU-S

USD 330.00

2 Weeks

PSMA5 (1-241, His-tag) human recombinant protein, 10 µg

Tag His-tag
Expression Host E. coli
Proteasome 20S alpha 5 (PSMA5) (NM_002790) Human Mass Spec Standard
PH310717

USD 2,055.00

3 Weeks

PSMA5 MS Standard C13 and N15-labeled recombinant protein (NP_002781)

Tag C-Myc/DDK
Expression Host HEK293
Proteasome 20S alpha 5 (PSMA5) ICC Control Block
TB410717

USD 1,040.00

4 Weeks

Transient overexpression of PSMA5 (NM_002790) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Proteasome 20S alpha 5 (PSMA5) ICC Control Block
TB431993

USD 1,070.00

4 Weeks

Transient overexpression of PSMA5 (NM_001199772) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Proteasome 20S alpha 5 (PSMA5) ICC Control Block
TB431994

USD 1,070.00

4 Weeks

Transient overexpression of PSMA5 (NM_001199773) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Proteasome 20S alpha 5 (PSMA5) ICC Control Block
TB431995

USD 1,070.00

4 Weeks

Transient overexpression of PSMA5 (NM_001199774) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Proteasome 20S alpha 5 (PSMA5) Cytosection
TS410717

USD 225.00

4 Weeks

Transient overexpression of PSMA5 (NM_002790) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Proteasome 20S alpha 5 (PSMA5) Cytosection
TS410717P5

USD 889.00

4 Weeks

Transient overexpression of PSMA5 (NM_002790) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Proteasome 20S alpha 5 (PSMA5) ICC Control Sections
TS431993P5

USD 889.00

4 Weeks

Transient overexpression of PSMA5 (NM_001199772) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Proteasome 20S alpha 5 (PSMA5) ICC Control Sections
TS431994P5

USD 889.00

4 Weeks

Transient overexpression of PSMA5 (NM_001199773) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Proteasome 20S alpha 5 (PSMA5) ICC Control Sections
TS431995P5

USD 889.00

4 Weeks

Transient overexpression of PSMA5 (NM_001199774) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack