RALA (Myc-DDK-tagged)-Human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RALA (Myc-DDK-tagged)-Human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, RALA (Myc-DDK tagged) - Human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, RALA (mGFP-tagged) - Human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
RALA (GFP-tagged) - Human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, RALA (Myc-DDK tagged) - Human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, RALA (mGFP-tagged) - Human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Transient overexpression lysate of v-ral simian leukemia viral oncogene homolog A (ras related) (RALA)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
RALA (untagged)-Human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
RALA HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal antibody to RALA (v-ral simian leukemia viral oncogene homolog A (ras related))
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 206 of RALA (Uniprot ID#P11233) |
Rabbit polyclonal Anti-RALA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RALA antibody: synthetic peptide directed towards the middle region of human RALA. Synthetic peptide located within the following region: GQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENV |
Rabbit anti RalA (pS196) Polyclonal Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit anti RalA (Paired S196) Polyclonal Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RALA / RAL (1-203, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
RALA / RAL (1-203, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
RALA MS Standard C13 and N15-labeled recombinant protein (NP_005393)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Anti-RALA Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 141-155 amino acids of human v-ral simian leukemia viral oncogene homolog A (ras related) |
Transient overexpression of RALA (NM_005402) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RALA (NM_005402) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RALA (NM_005402) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack