Products

View as table Download

USD 98.00

USD 390.00

In Stock

RALA (Myc-DDK-tagged)-Human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA)

Tag C-Myc/DDK
Expression Host HEK293T

Lenti ORF particles, RALA (Myc-DDK tagged) - Human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, RALA (mGFP-tagged) - Human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

RALA (GFP-tagged) - Human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, RALA (Myc-DDK tagged) - Human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, RALA (mGFP-tagged) - Human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

RALA (untagged)-Human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

RALA HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal antibody to RALA (v-ral simian leukemia viral oncogene homolog A (ras related))

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 206 of RALA (Uniprot ID#P11233)

Rabbit polyclonal Anti-RALA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RALA antibody: synthetic peptide directed towards the middle region of human RALA. Synthetic peptide located within the following region: GQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENV

Rabbit anti RalA (pS196) Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit anti RalA (Paired S196) Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RALA / RAL (1-203, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli

RALA / RAL (1-203, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli

RALA MS Standard C13 and N15-labeled recombinant protein (NP_005393)

Tag C-Myc/DDK
Expression Host HEK293

Anti-RALA Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 141-155 amino acids of human v-ral simian leukemia viral oncogene homolog A (ras related)

USD 1,040.00

4 Weeks

Transient overexpression of RALA (NM_005402) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of RALA (NM_005402) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of RALA (NM_005402) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack