Germany
Japan
United Kingdom
China
RALA (Myc-DDK-tagged)-Human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Rala (Myc-DDK-tagged) - Mouse v-ral simian leukemia viral oncogene homolog A (ras related) (Rala)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, RALA (Myc-DDK tagged) - Human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, RALA (mGFP-tagged) - Human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
RALA (GFP-tagged) - Human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
RALA - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN408076 is the updated version of KN208076.
Rala - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN514439 is the updated version of KN314439.
Rala (GFP-tagged) - Mouse v-ral simian leukemia viral oncogene homolog A (ras related) (Rala)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Rala (Myc-DDK-tagged) - Mouse v-ral simian leukemia viral oncogene homolog A (ras related) (Rala)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Rala (Myc-DDK-tagged) - Mouse v-ral simian leukemia viral oncogene homolog A (ras related) (Rala), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Rala (mGFP-tagged) - Mouse v-ral simian leukemia viral oncogene homolog A (ras related) (Rala)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Rala (GFP-tagged) - Mouse v-ral simian leukemia viral oncogene homolog A (ras related) (Rala), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, RALA (Myc-DDK tagged) - Human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, RALA (mGFP-tagged) - Human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rala (Myc-DDK-tagged ORF) - Rat v-ral simian leukemia viral oncogene homolog A (ras related) (Rala), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Rala (Myc-DDK-tagged ORF) - Rat v-ral simian leukemia viral oncogene homolog A (ras related) (Rala), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Rala (Myc-DDK-tagged ORF) - Rat v-ral simian leukemia viral oncogene homolog A (ras related) (Rala), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Rala (mGFP-tagged ORF) - Rat v-ral simian leukemia viral oncogene homolog A (ras related) (Rala), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Rala (GFP-tagged ORF) - Rat v-ral simian leukemia viral oncogene homolog A (ras related) (Rala), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
RALA - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
RALA (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Transient overexpression lysate of v-ral simian leukemia viral oncogene homolog A (ras related) (RALA)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
RALA (untagged)-Human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
RALA HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rala (untagged) - Mouse v-ral simian leukemia viral oncogene homolog A (ras related) (Rala), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Homo sapiens gene RALA
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Rabbit Polyclonal antibody to RALA (v-ral simian leukemia viral oncogene homolog A (ras related))
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 206 of RALA (Uniprot ID#P11233) |
Rabbit polyclonal Anti-RALA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RALA antibody: synthetic peptide directed towards the middle region of human RALA. Synthetic peptide located within the following region: GQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENV |
Rabbit anti RalA (pS196) Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti RalA (Paired S196) Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RALA - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
RALA / RAL (1-203, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
RALA / RAL (1-203, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
RALA CRISPRa kit - CRISPR gene activation of human RAS like proto-oncogene A
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene RALA
| Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Mus musculus gene Rala
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Rala
RALA MS Standard C13 and N15-labeled recombinant protein (NP_005393)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Rala (untagged ORF) - Rat v-ral simian leukemia viral oncogene homolog A (ras related) (Rala), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of v-ral simian leukemia viral oncogene homolog A (ras related) (RALA) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Rala (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Rala (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Anti-RALA Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 141-155 amino acids of human v-ral simian leukemia viral oncogene homolog A (ras related) |
Rala Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Rala |
RALA Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-206 of human RALA (NP_005393.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- RALA