Products

View as table Download

STK17A (Myc-DDK-tagged)-Human serine/threonine kinase 17a (STK17A)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

STK17A (GFP-tagged) - Human serine/threonine kinase 17a (STK17A)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human serine/threonine kinase 17a (STK17A), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human serine/threonine kinase 17a (STK17A), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

STK17A (untagged)-Human serine/threonine kinase 17a (STK17A)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

STK17A (untagged)-Kinase deficient mutant (K90M) of Human serine/threonine kinase 17a (STK17A)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-STK17A Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-STK17A antibody is: synthetic peptide directed towards the C-terminal region of Human STK17A. Synthetic peptide located within the following region: KSETKESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQE

Lenti ORF clone of Human serine/threonine kinase 17a (STK17A), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

STK17A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal DRAK1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DRAK1 antibody was raised against a peptide corresponding to amino acids near the amino terminus of human DRAK1.

Rabbit polyclonal antibody to DRAK1 (serine/threonine kinase 17a)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 231 of DRAK1 (Uniprot ID#Q9UEE5)

Rabbit Polyclonal Anti-STK17A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STK17A antibody: synthetic peptide directed towards the C terminal of human STK17A. Synthetic peptide located within the following region: KESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQEIPGE

STK17A / DRAK1 (His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli

STK17A / DRAK1 (His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli

Rabbit Polyclonal Anti-STK17A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human STK17A

Transient overexpression of STK17A (NM_004760) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of STK17A (NM_004760) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of STK17A (NM_004760) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack