Products

cDNA Clones (15)
Antibodies (10)
Proteins (8)
Jump to Filters
View as table Download
TATA binding protein (TBP) (NM_003194) Human Tagged ORF Clone
RC210727

USD 420.00

In Stock

TBP (Myc-DDK-tagged)-Human TATA box binding protein (TBP), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
TATA binding protein (TBP) (NM_003194) Human Tagged ORF Clone
RG210727

USD 460.00

In Stock

TBP (GFP-tagged) - Human TATA box binding protein (TBP), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TATA binding protein (TBP) (NM_003194) Human Untagged Clone
SC118124

USD 760.00

In Stock

TBP (untagged)-Human TATA box binding protein (TBP), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
TATA binding protein (TBP) (NM_001172085) Human Tagged ORF Clone
RC229881

USD 420.00

In Stock

TBP (Myc-DDK-tagged)-Human TATA box binding protein (TBP), transcript variant 2. Note: ORF is codon optimized

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
TATA binding protein (TBP) (NM_003194) Human Tagged ORF Clone Lentiviral Particle
RC210727L3V

USD 820.00

5 Weeks

Lenti ORF particles, TBP (Myc-DDK tagged) - Human TATA box binding protein (TBP), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TATA binding protein (TBP) (NM_003194) Human Tagged ORF Clone Lentiviral Particle
RC210727L4V

USD 820.00

7 Weeks

Lenti ORF particles, TBP (mGFP-tagged) - Human TATA box binding protein (TBP), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TATA binding protein (TBP) (NM_001172085) Human Tagged ORF Clone
RG229881

USD 460.00

Please Inquire

TBP (GFP-tagged) - Human TATA box binding protein (TBP), transcript variant 2. Note: ORF is codon optimized

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TATA binding protein (TBP) Goat Polyclonal Antibody
TA348990

USD 429.00

5 Days

Goat Polyclonal Anti-TNNI3 (aa117-127) Antibody

Applications WB
Reactivities Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-TNNI3 (aa117-127) Antibody: Peptide with sequence C-KVTKNITEIAD, from the internal region of the protein sequence according to NP_000354.4.
TATA binding protein (TBP) Goat Polyclonal Antibody
TA348995

USD 429.00

5 Days

Goat Polyclonal Anti-TBP /Transcription factor IID (aa39-50) Antibody

Applications WB
Reactivities Human, Mouse, Rat (Expected from sequence similarity: Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-TBP /Transcription factor IID (aa39-50) Antibody: Peptide with sequence C-TPQPIQNTNSLS, from the internal region of the protein sequence according to NP_003185.1; NP_001165556.1.
TATA binding protein (TBP) Rabbit Polyclonal Antibody
TA324859

USD 450.00

In Stock

Rabbit polyclonal anti-TBP antibody, Loading control

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 210-239 amino acids from the Central region of human TBP.
TATA binding protein (TBP) (NM_003194) Human Over-expression Lysate
LC401105

USD 121.00

In Stock

TBP HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
TATA binding protein (TBP) Goat Polyclonal Antibody
TA311260

USD 375.00

In Stock

Goat polyclonal anti-TBP antibody, Loading control

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence DQNNSLPPYAQ-C, from the N Terminus of the protein sequence according to NP_003185.1.
TATA binding protein (TBP) (NM_003194) Human Over-expression Lysate
LY401105

USD 396.00

5 Days

Transient overexpression lysate of TATA box binding protein (TBP), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
TATA binding protein (TBP) (NM_003194) Human Untagged Clone
SC322062

USD 760.00

In Stock

TBP (untagged)-Human TATA box binding protein (TBP), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
TATA binding protein (TBP) (NM_001172085) Human Untagged Clone
SC328519

USD 660.00

In Stock

TBP (untagged)-Human TATA box binding protein (TBP) transcript variant 2

Vector PCMV6-Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
TATA binding protein (TBP) Rabbit Polyclonal Antibody
TA308956

USD 240.00

In Stock

Rabbit Polyclonal antibody to TFIID (TATA box binding protein)

Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 158 and 339 of TFIID (Uniprot ID#P20226)
TATA binding protein (TBP) (NM_003194) Human Tagged ORF Clone
RC210727L2

USD 620.00

3 Weeks

Lenti ORF clone of Human TATA box binding protein (TBP), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
TATA binding protein (TBP) Rabbit Polyclonal Antibody
TA312082

USD 345.00

In Stock

Rabbit polyclonal anti-TBP antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TBP.
TATA binding protein (TBP) (C-term) Rabbit Polyclonal Antibody
AP17778PU-N

USD 450.00

2 Weeks

TATA binding protein (TBP) (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human TBP
TATA binding protein (TBP) Rabbit Polyclonal Antibody
TA330163

USD 310.00

5 Days

Rabbit Polyclonal Anti-TBP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TBP antibody: synthetic peptide directed towards the middle region of human TBP. Synthetic peptide located within the following region: FSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCD
TATA binding protein (TBP) ICC Control Block
TB410727

USD 1,070.00

4 Weeks

Transient overexpression of TBP (NM_003194) in HEK293T cells paraffin embedded controls for ICC/IHC staining

TATA binding protein (TBP) ICC Control Block
TB429881

USD 1,070.00

4 Weeks

Transient overexpression of TBP (NM_001172085) in HEK293T cells paraffin embedded controls for ICC/IHC staining

TATA binding protein (TBP) Cytosection
TS410727

USD 225.00

4 Weeks

Transient overexpression of TBP (NM_003194) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

TATA binding protein (TBP) Cytosection
TS410727P5

USD 889.00

4 Weeks

Transient overexpression of TBP (NM_003194) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

TATA binding protein (TBP) Cytosection
TS429881

USD 225.00

4 Weeks

Transient overexpression of TBP (NM_001172085) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

TATA binding protein (TBP) Cytosection
TS429881P5

USD 889.00

4 Weeks

Transient overexpression of TBP (NM_001172085) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack