VEGFC (Myc-DDK-tagged)-Human vascular endothelial growth factor C (VEGFC)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
VEGFC (Myc-DDK-tagged)-Human vascular endothelial growth factor C (VEGFC)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
VEGFC (GFP-tagged) - Human vascular endothelial growth factor C (VEGFC)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, VEGFC (Myc-DDK tagged) - Human vascular endothelial growth factor C (VEGFC), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, VEGFC (mGFP-tagged) - Human vascular endothelial growth factor C (VEGFC), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
VEGFC (untagged)-Human vascular endothelial growth factor C (VEGFC)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human vascular endothelial growth factor C (VEGFC), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, VEGFC (Myc-DDK tagged) - Human vascular endothelial growth factor C (VEGFC), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human vascular endothelial growth factor C (VEGFC), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, VEGFC (mGFP-tagged) - Human vascular endothelial growth factor C (VEGFC), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Purified recombinant protein of Human vascular endothelial growth factor C (VEGFC).
Tag | C-His |
Expression Host | HEK293 |
Lenti ORF clone of Human vascular endothelial growth factor C (VEGFC), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Purified recombinant protein of Human vascular endothelial growth factor C (VEGFC)
Tag | C-His |
Expression Host | CHO |
Rabbit polyclonal anti-VEGF-C antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | E. coli-expressed recombinant murine VEGF-C |
VEGFC (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 27-57 amino acids from the N-terminal region of human VEGF3 |
VEGFC mouse monoclonal antibody, clone 9E7, Purified
Applications | IF, IHC, WB |
Reactivities | Human, Rat |
Lenti ORF clone of Human vascular endothelial growth factor C (VEGFC), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
VEGFC HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Rabbit Polyclonal Anti-VEGFC Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-VEGFC antibody is: synthetic peptide directed towards the C-terminal region of Human VEGFC. Synthetic peptide located within the following region: LDEETCQCVCRAGLRPASCGPHKELDRNSCQCVCKNKLFPSQCGANREFD |
VEGF-C / Flt4-L (112-227, His-tag) human protein, 0.25 mg
Tag | His-tag |
VEGF-C / Flt4-L (112-227, His-tag) human protein, 50 µg
Tag | His-tag |
Carrier-free (BSA/glycerol-free) VEGFC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression lysate of vascular endothelial growth factor C (VEGFC)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Anti-VEGFC Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 256-270 amino acids of human vascular endothelial growth factor C |
VEGFC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
VEGFC mouse monoclonal antibody,clone 4A1, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
VEGFC mouse monoclonal antibody,clone 4A1, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
VEGFC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of VEGFC (NM_005429) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human vascular endothelial growth factor C (VEGFC)
Tag | C-His |
Expression Host | HEK293 |
Recombinant protein of human vascular endothelial growth factor C (VEGFC)
Tag | C-His |
Expression Host | HEK293 |
Recombinant protein of human vascular endothelial growth factor C (VEGFC)
Tag | C-His |
Expression Host | HEK293 |
Recombinant protein of human vascular endothelial growth factor C (VEGFC)
Tag | C-His |
Expression Host | HEK293 |
Transient overexpression of VEGFC (NM_005429) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of VEGFC (NM_005429) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack