Products

Proteins (13)

cDNA Clones (11)

Antibodies (10)

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 34 of 34 results

(reset)

VEGFC (NM_005429) Human Tagged ORF Clone

RC209451

USD 420.00

In Stock

VEGFC (Myc-DDK-tagged)-Human vascular endothelial growth factor C (VEGFC)

Vector	pCMV6-Entry
Tag	Myc-DDK
Mammalian Cell Selection	Neomycin

• 

VEGFC (NM_005429) Human Tagged ORF Clone

RG209451

USD 460.00

In Stock

VEGFC (GFP-tagged) - Human vascular endothelial growth factor C (VEGFC)

Vector	pCMV6-AC-GFP
Tag	TurboGFP
Mammalian Cell Selection	Neomycin

• TrueORF^®

VEGFC (NM_005429) Human Tagged ORF Clone Lentiviral Particle

RC209451L1V

USD 820.00

3 Weeks

Lenti ORF particles, VEGFC (Myc-DDK tagged) - Human vascular endothelial growth factor C (VEGFC), 200ul, >10^7 TU/mL

Vector	pLenti-C-Myc-DDK
Tag	Myc-DDK

• LentiORF^®
• 

VEGFC (NM_005429) Human Tagged ORF Clone Lentiviral Particle

RC209451L2V

USD 820.00

6 Weeks

Lenti ORF particles, VEGFC (mGFP-tagged) - Human vascular endothelial growth factor C (VEGFC), 200ul, >10^7 TU/mL

Vector	pLenti-C-mGFP
Tag	mGFP

• LentiORF^®
• 

VEGFC (NM_005429) Human Untagged Clone

SC116730

USD 310.00

In Stock

VEGFC (untagged)-Human vascular endothelial growth factor C (VEGFC)

Vector	pCMV6-XL4
Tag	Tag Free
Mammalian Cell Selection	None

VEGFC (NM_005429) Human Tagged ORF Clone

RC209451L3

USD 620.00

3 Weeks

Lenti ORF clone of Human vascular endothelial growth factor C (VEGFC), Myc-DDK-tagged

Vector	pLenti-C-Myc-DDK-P2A-Puro
Tag	Myc-DDK
Mammalian Cell Selection	Puromycin

• LentiORF^®

VEGFC (NM_005429) Human Tagged ORF Clone Lentiviral Particle

RC209451L3V

USD 820.00

5 Weeks

Lenti ORF particles, VEGFC (Myc-DDK tagged) - Human vascular endothelial growth factor C (VEGFC), 200ul, >10^7 TU/mL

Vector	pLenti-C-Myc-DDK-P2A-Puro
Tag	Myc-DDK
Mammalian Cell Selection	Puromycin

• LentiORF^®
• 

VEGFC (NM_005429) Human Tagged ORF Clone

RC209451L4

USD 620.00

3 Weeks

Lenti ORF clone of Human vascular endothelial growth factor C (VEGFC), mGFP tagged

Vector	pLenti-C-mGFP-P2A-Puro
Tag	mGFP
Mammalian Cell Selection	Puromycin

• LentiORF^®

VEGFC (NM_005429) Human Tagged ORF Clone Lentiviral Particle

RC209451L4V

USD 820.00

7 Weeks

Lenti ORF particles, VEGFC (mGFP-tagged) - Human vascular endothelial growth factor C (VEGFC), 200ul, >10^7 TU/mL

Vector	pLenti-C-mGFP-P2A-Puro
Tag	mGFP
Mammalian Cell Selection	Puromycin

• LentiORF^®
• 

VEGFC (NM_005429) Human Recombinant Protein

TP723474

USD 240.00

In Stock

Purified recombinant protein of Human vascular endothelial growth factor C (VEGFC).

Tag	C-His
Expression Host	HEK293

VEGFC (NM_005429) Human Tagged ORF Clone

RC209451L1

USD 768.00

In Stock

Lenti ORF clone of Human vascular endothelial growth factor C (VEGFC), Myc-DDK-tagged

Vector	pLenti-C-Myc-DDK
Tag	Myc-DDK
Mammalian Cell Selection	None

• LentiORF^®

1 / 2

2 / 2

Previous Next

VEGFC (NM_005429) Human Recombinant Protein

TP723856

USD 205.00

3 Weeks

Purified recombinant protein of Human vascular endothelial growth factor C (VEGFC)

Tag	C-His
Expression Host	CHO

VEGFC Rabbit Polyclonal Antibody

TA319108

USD 355.00

In Stock

Rabbit polyclonal anti-VEGF-C antibody

Applications	WB
Reactivities	Mouse
Conjugation	Unconjugated
Immunogen	E. coli-expressed recombinant murine VEGF-C

VEGFC (N-term) Rabbit Polyclonal Antibody

AP54506PU-N

USD 450.00

2 Weeks

VEGFC (N-term) rabbit polyclonal antibody, Aff - Purified

Applications	FC, IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 27-57 amino acids from the N-terminal region of human VEGF3

1 / 3

2 / 3

3 / 3

Previous Next

VEGFC Mouse Monoclonal Antibody [Clone ID: 9E7]

DM3527

USD 340.00

2 Weeks

VEGFC mouse monoclonal antibody, clone 9E7, Purified

Applications	IF, IHC, WB
Reactivities	Human, Rat

1 / 3

2 / 3

3 / 3

Previous Next

VEGFC (NM_005429) Human Tagged ORF Clone

RC209451L2

USD 620.00

3 Weeks

Lenti ORF clone of Human vascular endothelial growth factor C (VEGFC), mGFP tagged

Vector	pLenti-C-mGFP
Tag	mGFP
Mammalian Cell Selection	None

• LentiORF^®

VEGFC (NM_005429) Human Over-expression Lysate

LC401667

USD 121.00

In Stock

VEGFC HEK293T cell transient overexpression lysate (as WB positive control)

Tag	C-Myc/DDK
Expression Host	HEK293T

VEGFC Rabbit Polyclonal Antibody

TA343278

USD 375.00

5 Days

Rabbit Polyclonal Anti-VEGFC Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-VEGFC antibody is: synthetic peptide directed towards the C-terminal region of Human VEGFC. Synthetic peptide located within the following region: LDEETCQCVCRAGLRPASCGPHKELDRNSCQCVCKNKLFPSQCGANREFD

VEGF-C / Flt4-L (112-227, His-tag) Human Protein

AR52036PU-N

USD 1,445.00

2 Weeks

VEGF-C / Flt4-L (112-227, His-tag) human protein, 0.25 mg

Tag

His-tag

VEGF-C / Flt4-L (112-227, His-tag) Human Protein

AR52036PU-S

USD 415.00

2 Weeks

VEGF-C / Flt4-L (112-227, His-tag) human protein, 50 µg

Tag

His-tag

VEGFC Mouse Monoclonal Antibody [Clone ID: OTI4A1]

CF801089

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) VEGFC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

VEGFC (NM_005429) Human Over-expression Lysate

LY401667

USD 396.00

5 Days

Transient overexpression lysate of vascular endothelial growth factor C (VEGFC)

Tag	C-Myc/DDK
Expression Host	HEK293T
Applications	WB

VEGFC Rabbit Polyclonal Antibody

TA321716

USD 345.00

In Stock

Anti-VEGFC Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 256-270 amino acids of human vascular endothelial growth factor C

VEGFC Mouse Monoclonal Antibody [Clone ID: OTI4A1]

TA801089

USD 379.00

In Stock

VEGFC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

VEGFC Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4A1]

TA801089AM

USD 420.00

5 Days

VEGFC mouse monoclonal antibody,clone 4A1, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

VEGFC Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A1]

TA801089BM

USD 420.00

5 Days

VEGFC mouse monoclonal antibody,clone 4A1, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

VEGFC Mouse Monoclonal Antibody [Clone ID: OTI4A1]

TA801089S

USD 159.00

2 Days

VEGFC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

VEGFC ICC Control Block

TB409451

USD 1,070.00

4 Weeks

Transient overexpression of VEGFC (NM_005429) in HEK293T cells paraffin embedded controls for ICC/IHC staining

VEGFC (NM_005429) Human Recombinant Protein

TP720451

USD 330.00

3 Weeks

Recombinant protein of human vascular endothelial growth factor C (VEGFC)

Tag	C-His
Expression Host	HEK293

VEGFC (NM_005429) Human Recombinant Protein

TP720451L

USD 1,900.00

3 Weeks

Recombinant protein of human vascular endothelial growth factor C (VEGFC)

Tag	C-His
Expression Host	HEK293

VEGFC (NM_005429) Human Recombinant Protein

TP720451M

USD 760.00

3 Weeks

Recombinant protein of human vascular endothelial growth factor C (VEGFC)

Tag	C-His
Expression Host	HEK293

VEGFC (NM_005429) Human Recombinant Protein

TP720451XL

USD 2,800.00

3 Weeks

Recombinant protein of human vascular endothelial growth factor C (VEGFC)

Tag	C-His
Expression Host	HEK293

VEGFC Cytosection

TS409451

USD 225.00

4 Weeks

Transient overexpression of VEGFC (NM_005429) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

VEGFC Cytosection

TS409451P5

USD 889.00

4 Weeks

Transient overexpression of VEGFC (NM_005429) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

1 - 34 of 34 results