Germany
Japan
United Kingdom
China
Lenti ORF particles, PAX3 (Myc-DDK-tagged)-Human paired box 3 (PAX3), transcript variant PAX3B, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Products
View as table Download
Lenti-ORF clone of PAX3 (Myc-DDK-tagged)-Human paired box 3 (PAX3), transcript variant PAX3B
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human paired box 3 (PAX3), transcript variant PAX3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human paired box 3 (PAX3), transcript variant PAX3D, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human paired box 3 (PAX3), transcript variant PAX3E, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Purified recombinant protein of Human paired box 3 (PAX3), transcript variant PAX3D, with N-terminal HIS tag, expressed in E.Coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Transient overexpression lysate of paired box 3 (PAX3), transcript variant PAX3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
LY405766 is the same product as LY430530.
PAX3 (untagged)-Human paired box 3 (PAX3), transcript variant PAX3
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal PAX3 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PAX3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 98-126 amino acids from the N-terminal region of human PAX3. |
Lenti ORF clone of Human paired box 3 (PAX3), transcript variant PAX3, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human paired box 3 (PAX3), transcript variant PAX3D, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-PAX3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAX3 antibody: synthetic peptide directed towards the C terminal of human PAX3. Synthetic peptide located within the following region: GGVPHQPQTDYALSPLTGGLEPTTTVSASCSQRLDHMKSLDSLPTSQSYC |
PAX3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PAX3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of paired box 3 (PAX3), transcript variant PAX3G
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
LY405770 is the same product as LY430533.
Goat Polyclonal Antibody against PAX3
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence TTLAGAVPRMM-C, from the N Terminus of the protein sequence according to NP_000429.2; NP_039230.1; NP_852122;.1 NP_852123.1; NP_852124.1; NP_852125.1; NP_852126.1. |
Rabbit Polyclonal Anti-PAX3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAX3 antibody: synthetic peptide directed towards the N terminal of human PAX3. Synthetic peptide located within the following region: DRNTVPSVSSISRILRSKFGKGEEEEADLERKEAEESEKKAKHSIDGILS |
Rabbit Polyclonal Anti-PAX3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAX3 antibody: synthetic peptide directed towards the middle region of human PAX3. Synthetic peptide located within the following region: KGEEEEADLERKEAEESEKKAKHSIDGILSERASAPQSDEGSDIDSEPDL |
Carrier-free (BSA/glycerol-free) PAX3 mouse monoclonal antibody, clone OTI4D1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PAX3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PAX3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PAX3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PAX3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PAX3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of paired box 3 (PAX3), transcript variant PAX3D
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of paired box 3 (PAX3), transcript variant PAX3E
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
LY405768 is the same product as LY430531.
Transient overexpression lysate of paired box 3 (PAX3), transcript variant PAX3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of paired box 3 (PAX3), transcript variant PAX3E
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of paired box 3 (PAX3), transcript variant PAX3G
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PAX3 MS Standard C13 and N15-labeled recombinant protein (NP_852122)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
PAX3 (untagged)-Human paired box 3 (PAX3), transcript variant PAX3E
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PAX3 (untagged)-Human paired box 3 (PAX3), transcript variant PAX3B
| Vector | pCMV6 series |
| Tag | Tag Free |
PAX3 (untagged)-Human paired box 3 (PAX3), transcript variant PAX3D
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PAX3 (untagged)-Human paired box 3 (PAX3), transcript variant PAX3H
| Vector | pCMV6 series |
| Tag | Tag Free |
PAX3 (untagged)-Human paired box 3 (PAX3), transcript variant PAX3G
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PAX3 (untagged)-Human paired box 3 (PAX3), transcript variant PAX3A
| Vector | pCMV6 series |
| Tag | Tag Free |
PAX3 (untagged)-Human paired box 3 (PAX3), transcript variant PAX3I
| Vector | pCMV6 series |
| Tag | Tag Free |
PAX3 mouse monoclonal antibody,clone OTI4D1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PAX3 mouse monoclonal antibody,clone OTI4D1, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
PAX3 mouse monoclonal antibody,clone OTI4D1, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
PAX3 mouse monoclonal antibody,clone OTI4D1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Transient overexpression of PAX3 (NM_013942) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PAX3 (NM_181457) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PAX3 (NM_181460) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PAX3 (NM_181458) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PAX3 (NM_181459) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PAX3 (NM_181461) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PAX3 (NM_000438) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PAX3 (NM_001127366) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PAX3 (NM_013942) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Active filters
Target Symbol
- PAX3
Families
- ES Cell Differentiation/IPS